DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm2 and fbxl14a

DIOPT Version :9

Sequence 1:NP_001262400.1 Gene:Kdm2 / 41090 FlyBaseID:FBgn0037659 Length:1345 Species:Drosophila melanogaster
Sequence 2:NP_958890.1 Gene:fbxl14a / 333988 ZFINID:ZDB-GENE-030131-5920 Length:411 Species:Danio rerio


Alignment Length:304 Identity:65/304 - (21%)
Similarity:129/304 - (42%) Gaps:78/304 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1056 HYSSSQNLALDPTVLKIIFRYLPQDTLVTCCSVCKVWSNAAVDPDLWKKMNCSEH--KMSASLLT 1118
            |.||     |.|.:|.:||.||..........||..|.:|:....:|:.:....|  :.:.||..
Zfish     4 HISS-----LFPEILAMIFNYLDVKGKGRVAQVCTAWRDASYHKSVWRGVEAKLHLRRANPSLFP 63

  Fly  1119 AIVRRQPEHLILDWTQI--AKRQLAWLVARLPALKNLSLQNCP-----------IQAVLALHTCL 1170
            ::..|.     :...||  .:|.|::::..:|.:::|:|..|.           :|.:       
Zfish    64 SLQTRG-----IKKVQILSLRRSLSYVIQGMPNIESLNLSGCYNLTDNGLGHAFVQDI------- 116

  Fly  1171 CPPLQTLDLSFVRGLNDAAIRDILSPPKDSRPGLSDSKTRLRDLKVMKLAG-TDISDVAVRYITQ 1234
             |.|:.|:||..:.:.|:::..|..              .|::|:::.|.| ::|::..:..|..
Zfish   117 -PSLRILNLSLCKQITDSSLGRIAQ--------------YLKNLELLDLGGCSNITNTGLLLIAW 166

  Fly  1235 SLPYLRHLDLSSCQRITDAGVAQIGTSTTATAR----LTELNLSACRLVSENALEHLAK------ 1289
            .|..|:.|:|.||:.::|.|:..:...|.:.|.    |..|.|..|:.:::.:|:|::|      
Zfish   167 GLHNLKSLNLRSCRHVSDVGIGHLAGMTRSAAEGCLTLEHLTLQDCQKLTDLSLKHISKGLNKLK 231

  Fly  1290 ------CEGL-------------IW-LDLRHVPQVSTQSVIRFA 1313
                  |.|:             :| |:||....:|...::..:
Zfish   232 VLNLSFCGGISDAGMIHLSHMTQLWTLNLRSCDNISDTGIMHLS 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm2NP_001262400.1 cupin_like 231..331 CDD:304367
PRTases_typeI <394..>467 CDD:294217
zf-CXXC 670..716 CDD:251032
PHD_4 721..801 CDD:293471
F-box-like <1073..1108 CDD:289689 9/34 (26%)
leucine-rich repeat 1102..1125 CDD:275381 5/24 (21%)
leucine-rich repeat 1126..1149 CDD:275381 4/24 (17%)
leucine-rich repeat 1150..1173 CDD:275381 4/33 (12%)
AMN1 1166..>1320 CDD:187754 37/179 (21%)
leucine-rich repeat 1174..1213 CDD:275381 7/38 (18%)
leucine-rich repeat 1214..1238 CDD:275381 6/24 (25%)
leucine-rich repeat 1239..1267 CDD:275381 8/27 (30%)
leucine-rich repeat 1268..1292 CDD:275381 8/35 (23%)
leucine-rich repeat 1293..1317 CDD:275381 5/35 (14%)
fbxl14aNP_958890.1 F-box-like 5..46 CDD:289689 13/45 (29%)
AMN1 90..243 CDD:187754 37/174 (21%)
leucine-rich repeat 92..118 CDD:275381 4/33 (12%)
leucine-rich repeat 119..144 CDD:275381 7/38 (18%)
leucine-rich repeat 145..170 CDD:275381 6/24 (25%)
leucine-rich repeat 171..203 CDD:275381 9/31 (29%)
leucine-rich repeat 204..229 CDD:275381 7/24 (29%)
AMN1 230..397 CDD:187754 7/46 (15%)
leucine-rich repeat 230..254 CDD:275381 2/23 (9%)
leucine-rich repeat 255..280 CDD:275381 5/21 (24%)
leucine-rich repeat 281..304 CDD:275381
leucine-rich repeat 307..331 CDD:275381
leucine-rich repeat 332..357 CDD:275381
leucine-rich repeat 358..377 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.