DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm2 and CG15056

DIOPT Version :9

Sequence 1:NP_001262400.1 Gene:Kdm2 / 41090 FlyBaseID:FBgn0037659 Length:1345 Species:Drosophila melanogaster
Sequence 2:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster


Alignment Length:223 Identity:39/223 - (17%)
Similarity:75/223 - (33%) Gaps:85/223 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly  1076 YLPQDTLVTC-------CSVCKVWSNAAVDPDLWKKMNCSEHKMS--ASLLTAIVRRQPEHLI-- 1129
            ::.:|.::.|       .|:|              .:|..|:::.  ..|.:.:::......|  
  Fly   220 HIYRDLVLACPL
LVMVEISIC--------------SLNRDEYRLGELRYLQSLVIKAHSTDTIRC 270

  Fly  1130 --LDWTQIAKRQLAWLVARLPALKNLSLQNCPIQAVLALHTCLCPPLQTLDLSFVRGLNDAAIRD 1192
              .||..|:       :..:|.|:||...:.|                       .|...|....
  Fly   271 KVSDWMLIS-------LLDVPF
LRNLMFSDAP-----------------------SGFVSANALS 305

  Fly  1193 ILSPPKDSRPGLSDSKTRLRDLKVMKLAG-----TDISDVAVRYITQSLPYLRHLDLSSCQRITD 1252
            |:|              |.|.|:|:|:..     .|:..:      ::|.:|..||||:...||:
  Fly   306 IIS--------------RFRQLRVLKMPNQPYRPNDLLRL------RNLTFLETLDLSNSPYITN 350

  Fly  1253 AGVAQIGTSTTATARLTELNLSACRLVS 1280
            ..|.::   ......|:.|.:..|.|::
  Fly   351 EVVIEL---VIGIPNLSVLIVQGCPLLT 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm2NP_001262400.1 cupin_like 231..331 CDD:304367
PRTases_typeI <394..>467 CDD:294217
zf-CXXC 670..716 CDD:251032
PHD_4 721..801 CDD:293471
F-box-like <1073..1108 CDD:289689 5/38 (13%)
leucine-rich repeat 1102..1125 CDD:275381 3/24 (13%)
leucine-rich repeat 1126..1149 CDD:275381 4/26 (15%)
leucine-rich repeat 1150..1173 CDD:275381 4/22 (18%)
AMN1 1166..>1320 CDD:187754 23/120 (19%)
leucine-rich repeat 1174..1213 CDD:275381 5/38 (13%)
leucine-rich repeat 1214..1238 CDD:275381 5/28 (18%)
leucine-rich repeat 1239..1267 CDD:275381 8/27 (30%)
leucine-rich repeat 1268..1292 CDD:275381 4/13 (31%)
leucine-rich repeat 1293..1317 CDD:275381
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381
leucine-rich repeat 157..179 CDD:275381
leucine-rich repeat 180..204 CDD:275381
leucine-rich repeat 205..231 CDD:275381 2/10 (20%)
leucine-rich repeat 232..285 CDD:275381 9/73 (12%)
leucine-rich repeat 286..326 CDD:275381 13/76 (17%)
AMN1 306..>376 CDD:187754 21/93 (23%)
leucine-rich repeat 337..362 CDD:275381 8/27 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.