Sequence 1: | NP_001262400.1 | Gene: | Kdm2 / 41090 | FlyBaseID: | FBgn0037659 | Length: | 1345 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_573291.1 | Gene: | CG15056 / 32824 | FlyBaseID: | FBgn0030918 | Length: | 399 | Species: | Drosophila melanogaster |
Alignment Length: | 223 | Identity: | 39/223 - (17%) |
---|---|---|---|
Similarity: | 75/223 - (33%) | Gaps: | 85/223 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 1076 YLPQDTLVTC-------CSVCKVWSNAAVDPDLWKKMNCSEHKMS--ASLLTAIVRRQPEHLI-- 1129
Fly 1130 --LDWTQIAKRQLAWLVARLPALKNLSLQNCPIQAVLALHTCLCPPLQTLDLSFVRGLNDAAIRD 1192
Fly 1193 ILSPPKDSRPGLSDSKTRLRDLKVMKLAG-----TDISDVAVRYITQSLPYLRHLDLSSCQRITD 1252
Fly 1253 AGVAQIGTSTTATARLTELNLSACRLVS 1280 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Kdm2 | NP_001262400.1 | cupin_like | 231..331 | CDD:304367 | |
PRTases_typeI | <394..>467 | CDD:294217 | |||
zf-CXXC | 670..716 | CDD:251032 | |||
PHD_4 | 721..801 | CDD:293471 | |||
F-box-like | <1073..1108 | CDD:289689 | 5/38 (13%) | ||
leucine-rich repeat | 1102..1125 | CDD:275381 | 3/24 (13%) | ||
leucine-rich repeat | 1126..1149 | CDD:275381 | 4/26 (15%) | ||
leucine-rich repeat | 1150..1173 | CDD:275381 | 4/22 (18%) | ||
AMN1 | 1166..>1320 | CDD:187754 | 23/120 (19%) | ||
leucine-rich repeat | 1174..1213 | CDD:275381 | 5/38 (13%) | ||
leucine-rich repeat | 1214..1238 | CDD:275381 | 5/28 (18%) | ||
leucine-rich repeat | 1239..1267 | CDD:275381 | 8/27 (30%) | ||
leucine-rich repeat | 1268..1292 | CDD:275381 | 4/13 (31%) | ||
leucine-rich repeat | 1293..1317 | CDD:275381 | |||
CG15056 | NP_573291.1 | leucine-rich repeat | 133..156 | CDD:275381 | |
leucine-rich repeat | 157..179 | CDD:275381 | |||
leucine-rich repeat | 180..204 | CDD:275381 | |||
leucine-rich repeat | 205..231 | CDD:275381 | 2/10 (20%) | ||
leucine-rich repeat | 232..285 | CDD:275381 | 9/73 (12%) | ||
leucine-rich repeat | 286..326 | CDD:275381 | 13/76 (17%) | ||
AMN1 | 306..>376 | CDD:187754 | 21/93 (23%) | ||
leucine-rich repeat | 337..362 | CDD:275381 | 8/27 (30%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |