DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm2 and Fbxl4

DIOPT Version :9

Sequence 1:NP_001262400.1 Gene:Kdm2 / 41090 FlyBaseID:FBgn0037659 Length:1345 Species:Drosophila melanogaster
Sequence 2:NP_001382505.1 Gene:Fbxl4 / 313101 RGDID:1305724 Length:621 Species:Rattus norvegicus


Alignment Length:335 Identity:77/335 - (22%)
Similarity:117/335 - (34%) Gaps:99/335 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1054 NQHYSSSQNLALDPT----------VLKIIFRYLPQDTLVTCCSVCKVWSNAAVDPDLWKKMNCS 1108
            |:.:||: .|...|:          ::::|..:|....|......|::......||..:..:|..
  Rat   263 NKKFSSA-TLGDGPSNGYFDKLPYELIQLILNHLSLPDLCRLAQTCRLLHQHCCDPLQYIHLNLQ 326

  Fly  1109 EHKMSASLLTAIVRRQPEHLILDWTQIAKRQLAWLVARLPALK--NLS----------------L 1155
            .:                     |.::....|.:|.||...::  |||                |
  Rat   327 PY---------------------WAKLDDTSLEFLQARCALVQWLNLSWTGNRGFISVSGFSRFL 370

  Fly  1156 QNCPIQAVLALHTC--------------LCPPLQTLDLSFVRGLNDAAIRDILSPPKDSRPGLSD 1206
            :.|..:.|....:|              :||.||.|:||....|...|...|             
  Rat   371 KVCGSELVRLELSCSHFLNDACLEVISEMCPNLQDLNLSSCDKLPPQAFGHI------------- 422

  Fly  1207 SKTRLRDLKVMKLAGTDISDVAVRYITQSLPYLRHLDLSSCQRITDAGV--AQIGTSTTATARLT 1269
              .:||.||.:.|..|.:...|:..|......|:||.|.||..|.|..|  :.||....:   |.
  Rat   423 --AKLRSLKRLILYRTKVEQTALLSILNFCAELQHLSLGSCVMIEDYDVIASMIGAKCKS---LR 482

  Fly  1270 ELNLSACRLVSENALEHLAK-CEGLIWLDLRHVP--QVSTQSVIRFASNSKHDLCVRDIKLVERR 1331
            .|:|..|:.::||.:..||. |..|..|||...|  |.||....|.|            :.:...
  Rat   483 TLDLWRCKNITENGIAELASGCALLEELDLGWCPTLQSSTGCFARLA------------RQLPNL 535

  Fly  1332 RRNSTTANRS 1341
            ::...|||||
  Rat   536 QKLFLTANRS 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm2NP_001262400.1 cupin_like 231..331 CDD:304367
PRTases_typeI <394..>467 CDD:294217
zf-CXXC 670..716 CDD:251032
PHD_4 721..801 CDD:293471
F-box-like <1073..1108 CDD:289689 7/34 (21%)
leucine-rich repeat 1102..1125 CDD:275381 1/22 (5%)
leucine-rich repeat 1126..1149 CDD:275381 5/22 (23%)
leucine-rich repeat 1150..1173 CDD:275381 8/54 (15%)
AMN1 1166..>1320 CDD:187754 49/172 (28%)
leucine-rich repeat 1174..1213 CDD:275381 9/38 (24%)
leucine-rich repeat 1214..1238 CDD:275381 6/23 (26%)
leucine-rich repeat 1239..1267 CDD:275381 11/29 (38%)
leucine-rich repeat 1268..1292 CDD:275381 9/24 (38%)
leucine-rich repeat 1293..1317 CDD:275381 10/25 (40%)
Fbxl4NP_001382505.1 F-box-like 280..318 CDD:403981 5/37 (14%)
leucine-rich repeat 295..317 CDD:275381 3/21 (14%)
leucine-rich repeat 318..340 CDD:275381 3/42 (7%)
leucine-rich repeat 347..376 CDD:275381 5/28 (18%)
leucine-rich repeat 377..402 CDD:275381 3/24 (13%)
AMN1 394..601 CDD:187754 53/182 (29%)
leucine-rich repeat 403..427 CDD:275381 9/38 (24%)
leucine-rich repeat 428..452 CDD:275381 6/23 (26%)
leucine-rich repeat 453..480 CDD:275381 11/26 (42%)
leucine-rich repeat 481..506 CDD:275381 9/24 (38%)
leucine-rich repeat 507..534 CDD:275381 10/38 (26%)
leucine-rich repeat 535..560 CDD:275381 5/11 (45%)
leucine-rich repeat 561..586 CDD:275381
leucine-rich repeat 587..612 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.