| Sequence 1: | NP_001262400.1 | Gene: | Kdm2 / 41090 | FlyBaseID: | FBgn0037659 | Length: | 1345 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001101073.1 | Gene: | Fbxl15 / 309453 | RGDID: | 1306444 | Length: | 300 | Species: | Rattus norvegicus |
| Alignment Length: | 219 | Identity: | 59/219 - (26%) |
|---|---|---|---|
| Similarity: | 94/219 - (42%) | Gaps: | 30/219 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1077 LPQDTLVTCCSVCKVWSNAAVDPDLWKKMNCSEHKMSASLLTAIVRRQPE---HLILDWTQIAKR 1138
Fly 1139 QLAWLVARLPALKNLSLQNCPIQAVLALHTCL--CPPLQTLDLSFVRGLNDAAIRDILSPPKDSR 1201
Fly 1202 PGLSDSKTRLRDLKVMKLA-GTDISDVAVRYITQSLPYLRHLDLSSCQRITDAGVAQIGTSTTAT 1265
Fly 1266 ARLTELNLSACRLVSENALEHLAK 1289 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Kdm2 | NP_001262400.1 | cupin_like | 231..331 | CDD:304367 | |
| PRTases_typeI | <394..>467 | CDD:294217 | |||
| zf-CXXC | 670..716 | CDD:251032 | |||
| PHD_4 | 721..801 | CDD:293471 | |||
| F-box-like | <1073..1108 | CDD:289689 | 5/30 (17%) | ||
| leucine-rich repeat | 1102..1125 | CDD:275381 | 4/22 (18%) | ||
| leucine-rich repeat | 1126..1149 | CDD:275381 | 4/25 (16%) | ||
| leucine-rich repeat | 1150..1173 | CDD:275381 | 8/24 (33%) | ||
| AMN1 | 1166..>1320 | CDD:187754 | 38/127 (30%) | ||
| leucine-rich repeat | 1174..1213 | CDD:275381 | 10/38 (26%) | ||
| leucine-rich repeat | 1214..1238 | CDD:275381 | 6/24 (25%) | ||
| leucine-rich repeat | 1239..1267 | CDD:275381 | 10/27 (37%) | ||
| leucine-rich repeat | 1268..1292 | CDD:275381 | 8/22 (36%) | ||
| leucine-rich repeat | 1293..1317 | CDD:275381 | |||
| Fbxl15 | NP_001101073.1 | F-box | 18..55 | CDD:395521 | |
| leucine-rich repeat | 62..88 | CDD:275381 | 3/13 (23%) | ||
| leucine-rich repeat | 89..115 | CDD:275381 | 6/33 (18%) | ||
| Interaction with SMURF1. /evidence=ECO:0000250 | 113..269 | 50/172 (29%) | |||
| leucine-rich repeat | 116..141 | CDD:275381 | 4/24 (17%) | ||
| AMN1 | <139..>268 | CDD:187754 | 44/144 (31%) | ||
| leucine-rich repeat | 142..167 | CDD:275381 | 8/24 (33%) | ||
| leucine-rich repeat | 168..194 | CDD:275381 | 10/38 (26%) | ||
| leucine-rich repeat | 195..220 | CDD:275381 | 6/24 (25%) | ||
| leucine-rich repeat | 221..245 | CDD:275381 | 9/23 (39%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||