| Sequence 1: | NP_001262400.1 | Gene: | Kdm2 / 41090 | FlyBaseID: | FBgn0037659 | Length: | 1345 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_038951543.1 | Gene: | Fbxl21 / 306750 | RGDID: | 1305555 | Length: | 460 | Species: | Rattus norvegicus |
| Alignment Length: | 251 | Identity: | 57/251 - (22%) |
|---|---|---|---|
| Similarity: | 91/251 - (36%) | Gaps: | 67/251 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1069 VLKIIFRYLPQDTLVTCCSVCKVWSNAAVDPDLWKKMNCSEHKMSAS--------LLTAIVRRQP 1125
Fly 1126 EHL------ILDWTQIAKRQLAWLVARLPALKNLS-LQNCPIQAVLALHTCLCPPLQTLDLS-FV 1182
Fly 1183 RGLNDAAIRDILSPPKDSRPGLSDSKTRLRDLKVMKLAGTDISDVAVR-YITQSLPYLRHLDLSS 1246
Fly 1247 CQRITDAGVAQIGTSTTATARL------------------TELNLSACRL--VSEN 1282 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Kdm2 | NP_001262400.1 | cupin_like | 231..331 | CDD:304367 | |
| PRTases_typeI | <394..>467 | CDD:294217 | |||
| zf-CXXC | 670..716 | CDD:251032 | |||
| PHD_4 | 721..801 | CDD:293471 | |||
| F-box-like | <1073..1108 | CDD:289689 | 14/34 (41%) | ||
| leucine-rich repeat | 1102..1125 | CDD:275381 | 5/30 (17%) | ||
| leucine-rich repeat | 1126..1149 | CDD:275381 | 4/28 (14%) | ||
| leucine-rich repeat | 1150..1173 | CDD:275381 | 9/23 (39%) | ||
| AMN1 | 1166..>1320 | CDD:187754 | 26/139 (19%) | ||
| leucine-rich repeat | 1174..1213 | CDD:275381 | 4/39 (10%) | ||
| leucine-rich repeat | 1214..1238 | CDD:275381 | 4/24 (17%) | ||
| leucine-rich repeat | 1239..1267 | CDD:275381 | 7/27 (26%) | ||
| leucine-rich repeat | 1268..1292 | CDD:275381 | 9/35 (26%) | ||
| leucine-rich repeat | 1293..1317 | CDD:275381 | |||
| Fbxl21 | XP_038951543.1 | F-box-like | 68..111 | CDD:403981 | 14/35 (40%) |
| leucine-rich repeat | 206..231 | CDD:275381 | 4/24 (17%) | ||
| leucine-rich repeat | 232..257 | CDD:275381 | 7/24 (29%) | ||
| leucine-rich repeat | 258..283 | CDD:275381 | 2/24 (8%) | ||
| leucine-rich repeat | 284..318 | CDD:275381 | 6/12 (50%) | ||
| leucine-rich repeat | 329..365 | CDD:275381 | |||
| AMN1 | <359..>424 | CDD:187754 | |||
| leucine-rich repeat | 366..392 | CDD:275381 | |||
| leucine-rich repeat | 393..418 | CDD:275381 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||