DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm2 and FBXL6

DIOPT Version :9

Sequence 1:NP_001262400.1 Gene:Kdm2 / 41090 FlyBaseID:FBgn0037659 Length:1345 Species:Drosophila melanogaster
Sequence 2:NP_036294.2 Gene:FBXL6 / 26233 HGNCID:13603 Length:539 Species:Homo sapiens


Alignment Length:467 Identity:87/467 - (18%)
Similarity:134/467 - (28%) Gaps:196/467 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   992 PQYVVRPASGTGSSSSSGNGGSASATNGISNGSNQSGANSCGAGNGERGTNNGGLSGSNGLGNQH 1056
            |....:|.:|..|.:::....:.:.|.....|.:        ||.|:|                 
Human    75 PSAAAKPKAGLRSEAAAAPAPAPAPTPTPEEGPD--------AGWGDR----------------- 114

  Fly  1057 YSSSQNLALDPTVLKIIFRYL-----PQDTLVTCCSVCKVWSNAAVDPDLWKKMNCS-------- 1108
                  :.|:  :|..||..|     |...|.....||:.|..||..|.||..:..|        
Human   115 ------IPLE--ILVQIFGLLVAADGPMPFLGRAARVCRRWQEAASQPALWHTVTLSSPLVGRPA 171

  Fly  1109 ------EHKMSASL-------------LTAIVRRQPEHLILDWT----------------QIAKR 1138
                  |.|:.|||             ||.|..:...|.:|...                .:...
Human   172 KGGVKAEKKLLASLEWLMPNRFSQLQRLTLIHWKSQVHPVLKLVGECCPRLTFLKLSGCHGVTAD 236

  Fly  1139 QLAWLVARLPALKNLSLQNCPIQ---------------------------AVLA--LHTCLCPPL 1174
            .|..|......|.:|.||:..::                           |:|.  |.:| ||.|
Human   237 ALVMLAKACCQLHSLDLQHSMVESTAVVSFLEEAGSRMRKLWLTYSSQTTAILGALLGSC-CPQL 300

  Fly  1175 QTLDLSFVRGLNDAAI---------------------RDILSPPKDSRPGLSDSK--TRLRDLKV 1216
            |.|::|  .|:|..:|                     .:::..||....|::...  ..|.:|.:
Human   301 QVLEVS--TGINRNSIPLQLPVEALQKGCPQLQVLRLLNLMWLPKPPGRGVAPGPGFPSLEELCL 363

  Fly  1217 MKLAGTDISDVAVRYITQSLPYLRHLDLSSCQRITDAGVAQI-------------GTSTTAT--- 1265
            .......:|:..:..:....|.||.|||..|.|||.||:..:             |||...|   
Human   364 ASSTCNFVSNEVLGRLLHGSPNLRLLDLRGCARITPAGLQDLPCRELEQLHLGLYGTSDRLTLAK 428

  Fly  1266 --------------------------------------------ARLTELNLSACRLVSENALEH 1286
                                                        ..|..|||...|:........
Human   429 EGSPFLTQKWCHTLRELDLSGQGFSEKDLEQALAAFLSTPGGSHPALCSLNLRGTRVTPSTVSSV 493

  Fly  1287 LAKCEGLIWLDL 1298
            ::.|.||::|:|
Human   494 ISGCPGLLYLNL 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm2NP_001262400.1 cupin_like 231..331 CDD:304367
PRTases_typeI <394..>467 CDD:294217
zf-CXXC 670..716 CDD:251032
PHD_4 721..801 CDD:293471
F-box-like <1073..1108 CDD:289689 13/39 (33%)
leucine-rich repeat 1102..1125 CDD:275381 10/49 (20%)
leucine-rich repeat 1126..1149 CDD:275381 4/38 (11%)
leucine-rich repeat 1150..1173 CDD:275381 9/51 (18%)
AMN1 1166..>1320 CDD:187754 43/216 (20%)
leucine-rich repeat 1174..1213 CDD:275381 11/61 (18%)
leucine-rich repeat 1214..1238 CDD:275381 2/23 (9%)
leucine-rich repeat 1239..1267 CDD:275381 15/87 (17%)
leucine-rich repeat 1268..1292 CDD:275381 6/23 (26%)
leucine-rich repeat 1293..1317 CDD:275381 3/6 (50%)
FBXL6NP_036294.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 49..111 7/43 (16%)
F-box-like 113..163 CDD:289689 16/74 (22%)
LRR 1 177..203 7/25 (28%)
AMN1 185..398 CDD:187754 39/215 (18%)
leucine-rich repeat 196..221 CDD:275381 5/24 (21%)
LRR 2 204..229 2/24 (8%)
leucine-rich repeat 222..247 CDD:275381 2/24 (8%)
LRR 3 230..255 5/24 (21%)
leucine-rich repeat 248..299 CDD:275381 9/51 (18%)
LRR 4 281..307 10/28 (36%)
leucine-rich repeat 300..329 CDD:275381 7/30 (23%)
LRR 5 312..337 1/24 (4%)
leucine-rich repeat 330..357 CDD:275381 3/26 (12%)
LRR 6 341..365 5/23 (22%)
AMN1 <357..508 CDD:187754 29/149 (19%)
leucine-rich repeat 358..385 CDD:275381 3/26 (12%)
LRR 7 368..393 7/24 (29%)
leucine-rich repeat 386..409 CDD:275381 11/22 (50%)
LRR 8 394..419 6/24 (25%)
LRR 9 423..449 1/25 (4%)
leucine-rich repeat 442..474 CDD:275381 0/31 (0%)
LRR 10 453..481 3/27 (11%)
leucine-rich repeat 475..499 CDD:275381 6/23 (26%)
LRR 11 482..507 6/24 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.