DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm2 and FBXL13

DIOPT Version :9

Sequence 1:NP_001262400.1 Gene:Kdm2 / 41090 FlyBaseID:FBgn0037659 Length:1345 Species:Drosophila melanogaster
Sequence 2:NP_001381423.1 Gene:FBXL13 / 222235 HGNCID:21658 Length:825 Species:Homo sapiens


Alignment Length:289 Identity:67/289 - (23%)
Similarity:115/289 - (39%) Gaps:64/289 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1058 SSSQNLALDPT------------VLKIIFRYLPQDTLVTCCSVCKVWSNAAVDPDLWKKMNCSEH 1110
            |||:...:|.|            :|:|.| ||....::.|..|...|........||..::.|  
Human   230 SSSEVFLVDETLKCDISLLPERAILQIFF-YLSLKDVIICGQVNHAWMLMTQLNSLWNAIDFS-- 291

  Fly  1111 KMSASLLTAIVRRQPEHLILDWTQIAKRQLAWLVARLPALKNLSLQNCPIQAVLALHTCLCPPLQ 1175
                |:...|    |:..|:...|      .|   ||..|: |:.:.|.::.........|..||
Human   292 ----SVKNVI----PDKYIVSTLQ------RW---RLNVLR-LNFRGCLLRPKTFRSVSHCRNLQ 338

  Fly  1176 TLDLSFVRGLNDAAIRDILSPPKDSRPGLSDSKTRLRDLKVMKLAGTDISDVAVRYITQSLPYLR 1240
            .|::|......|.::|.|    .:..||          :..:.|:.|.|::..:|.:.:....|:
Human   339 ELNVSDCPTFTDESMRHI----SEGCPG----------VLCLNLSNTTITNRTMRLLPRHFHNLQ 389

  Fly  1241 HLDLSSCQRITDAGVAQIGTSTTATARLTELNLSACRLVSENALEHLA-KCEGLIWLDLRHVPQV 1304
            :|.|:.|:|.||.|:..:... ....:|..|:||.|..:|.....::| .|.|::.|.:..:|.:
Human   390 NLSLAYCRRFTDKGLQYLNLG-NGCHKLIYLDLSGCTQISVQGFRYIANSCTGIMHLTINDMPTL 453

  Fly  1305 STQSVIRFASNSKHDLCVRDIKLVERRRR 1333
            :             |.||:  .|||:..|
Human   454 T-------------DNCVK--ALVEKCSR 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm2NP_001262400.1 cupin_like 231..331 CDD:304367
PRTases_typeI <394..>467 CDD:294217
zf-CXXC 670..716 CDD:251032
PHD_4 721..801 CDD:293471
F-box-like <1073..1108 CDD:289689 8/34 (24%)
leucine-rich repeat 1102..1125 CDD:275381 4/22 (18%)
leucine-rich repeat 1126..1149 CDD:275381 5/22 (23%)
leucine-rich repeat 1150..1173 CDD:275381 4/22 (18%)
AMN1 1166..>1320 CDD:187754 33/154 (21%)
leucine-rich repeat 1174..1213 CDD:275381 9/38 (24%)
leucine-rich repeat 1214..1238 CDD:275381 4/23 (17%)
leucine-rich repeat 1239..1267 CDD:275381 8/27 (30%)
leucine-rich repeat 1268..1292 CDD:275381 8/24 (33%)
leucine-rich repeat 1293..1317 CDD:275381 2/23 (9%)
FBXL13NP_001381423.1 Sfi1 <112..>224 CDD:400658
F-box-like 245..289 CDD:403981 10/44 (23%)
leucine-rich repeat 285..312 CDD:275381 9/45 (20%)
AMN1 312..497 CDD:187754 43/187 (23%)
leucine-rich repeat 313..336 CDD:275381 4/23 (17%)
leucine-rich repeat 337..362 CDD:275381 7/28 (25%)
leucine-rich repeat 363..387 CDD:275381 4/23 (17%)
leucine-rich repeat 388..406 CDD:275381 8/17 (47%)
leucine-rich repeat 416..441 CDD:275381 8/24 (33%)
leucine-rich repeat 442..491 CDD:275381 9/41 (22%)
leucine-rich repeat 468..490 CDD:275381 67/289 (23%)
leucine-rich repeat 492..515 CDD:275381
leucine-rich repeat 518..542 CDD:275381
AMN1 529..737 CDD:187754
leucine-rich repeat 543..570 CDD:275381
leucine-rich repeat 571..596 CDD:275381
leucine-rich repeat 597..645 CDD:275381
leucine-rich repeat 646..671 CDD:275381
leucine-rich repeat 672..697 CDD:275381
leucine-rich repeat 698..723 CDD:275381
leucine-rich repeat 724..749 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.