DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm2 and B0564.9

DIOPT Version :9

Sequence 1:NP_001262400.1 Gene:Kdm2 / 41090 FlyBaseID:FBgn0037659 Length:1345 Species:Drosophila melanogaster
Sequence 2:NP_502528.2 Gene:B0564.9 / 178266 WormBaseID:WBGene00007208 Length:423 Species:Caenorhabditis elegans


Alignment Length:222 Identity:53/222 - (23%)
Similarity:87/222 - (39%) Gaps:50/222 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1089 CKVWSNAAVDPDLWKKMNCSEHKMSASLLTAIVRRQPEHL-ILDWTQIAKRQLAWLVARLPALKN 1152
            |.:.|:..|||.:.:                .:....||| |.....:....||:|..:  .||.
 Worm   175 CLMNSHFHVDPKILQ----------------FISN
TVEHLAIAVGHSLTINSLAFLKDK--RLKT 221

  Fly  1153 LSLQN-----CPIQAVLALHTCLCPPLQTLDLSFVRGLNDAAIRDILS-------PPKDSRPGLS 1205
            |:||.     |.::.::|    :...:..||||  |.:|....|.|..       ..|:::.|:.
 Worm   222 LNLQRSFISPCDLEHIVA----MADTITHLDLS--RSVNLLDCRQIAELVNLRHLSLKNNKEGVR 280

  Fly  1206 DSKTRLRDLKVMKLAGTDISDVAVRYIT-------QSLPYLRHLDLSSCQRITDAGVAQIGTSTT 1263
            |...:|......||  .::|.....|:|       .:|..|:.|.|.....:.|:...||    :
 Worm   281 DDSLQLIIKNCSKL--EELSLDCCEYLTVNSLITLGNLNNLKQLSLPGIVNVDDSVCLQI----S 339

  Fly  1264 ATARLTELNLSACRLVSENALEHLAKC 1290
            ..::||.||::.||.|.:..|..|..|
 Worm   340 RCSKLTYLNINFCRRVQKRGLLCLLSC 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm2NP_001262400.1 cupin_like 231..331 CDD:304367
PRTases_typeI <394..>467 CDD:294217
zf-CXXC 670..716 CDD:251032
PHD_4 721..801 CDD:293471
F-box-like <1073..1108 CDD:289689 5/18 (28%)
leucine-rich repeat 1102..1125 CDD:275381 0/22 (0%)
leucine-rich repeat 1126..1149 CDD:275381 7/23 (30%)
leucine-rich repeat 1150..1173 CDD:275381 7/27 (26%)
AMN1 1166..>1320 CDD:187754 34/139 (24%)
leucine-rich repeat 1174..1213 CDD:275381 12/45 (27%)
leucine-rich repeat 1214..1238 CDD:275381 6/30 (20%)
leucine-rich repeat 1239..1267 CDD:275381 6/27 (22%)
leucine-rich repeat 1268..1292 CDD:275381 10/23 (43%)
leucine-rich repeat 1293..1317 CDD:275381
B0564.9NP_502528.2 leucine-rich repeat 106..130 CDD:275381
leucine-rich repeat 131..159 CDD:275381
leucine-rich repeat 166..193 CDD:275381 5/33 (15%)
leucine-rich repeat 195..214 CDD:275381 6/18 (33%)
leucine-rich repeat 219..243 CDD:275381 7/27 (26%)
leucine-rich repeat 244..266 CDD:275381 8/23 (35%)
leucine-rich repeat 267..293 CDD:275381 4/25 (16%)
leucine-rich repeat 294..318 CDD:275381 5/25 (20%)
leucine-rich repeat 319..343 CDD:275381 6/27 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.