Sequence 1: | NP_001262400.1 | Gene: | Kdm2 / 41090 | FlyBaseID: | FBgn0037659 | Length: | 1345 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_502528.2 | Gene: | B0564.9 / 178266 | WormBaseID: | WBGene00007208 | Length: | 423 | Species: | Caenorhabditis elegans |
Alignment Length: | 222 | Identity: | 53/222 - (23%) |
---|---|---|---|
Similarity: | 87/222 - (39%) | Gaps: | 50/222 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 1089 CKVWSNAAVDPDLWKKMNCSEHKMSASLLTAIVRRQPEHL-ILDWTQIAKRQLAWLVARLPALKN 1152
Fly 1153 LSLQN-----CPIQAVLALHTCLCPPLQTLDLSFVRGLNDAAIRDILS-------PPKDSRPGLS 1205
Fly 1206 DSKTRLRDLKVMKLAGTDISDVAVRYIT-------QSLPYLRHLDLSSCQRITDAGVAQIGTSTT 1263
Fly 1264 ATARLTELNLSACRLVSENALEHLAKC 1290 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Kdm2 | NP_001262400.1 | cupin_like | 231..331 | CDD:304367 | |
PRTases_typeI | <394..>467 | CDD:294217 | |||
zf-CXXC | 670..716 | CDD:251032 | |||
PHD_4 | 721..801 | CDD:293471 | |||
F-box-like | <1073..1108 | CDD:289689 | 5/18 (28%) | ||
leucine-rich repeat | 1102..1125 | CDD:275381 | 0/22 (0%) | ||
leucine-rich repeat | 1126..1149 | CDD:275381 | 7/23 (30%) | ||
leucine-rich repeat | 1150..1173 | CDD:275381 | 7/27 (26%) | ||
AMN1 | 1166..>1320 | CDD:187754 | 34/139 (24%) | ||
leucine-rich repeat | 1174..1213 | CDD:275381 | 12/45 (27%) | ||
leucine-rich repeat | 1214..1238 | CDD:275381 | 6/30 (20%) | ||
leucine-rich repeat | 1239..1267 | CDD:275381 | 6/27 (22%) | ||
leucine-rich repeat | 1268..1292 | CDD:275381 | 10/23 (43%) | ||
leucine-rich repeat | 1293..1317 | CDD:275381 | |||
B0564.9 | NP_502528.2 | leucine-rich repeat | 106..130 | CDD:275381 | |
leucine-rich repeat | 131..159 | CDD:275381 | |||
leucine-rich repeat | 166..193 | CDD:275381 | 5/33 (15%) | ||
leucine-rich repeat | 195..214 | CDD:275381 | 6/18 (33%) | ||
leucine-rich repeat | 219..243 | CDD:275381 | 7/27 (26%) | ||
leucine-rich repeat | 244..266 | CDD:275381 | 8/23 (35%) | ||
leucine-rich repeat | 267..293 | CDD:275381 | 4/25 (16%) | ||
leucine-rich repeat | 294..318 | CDD:275381 | 5/25 (20%) | ||
leucine-rich repeat | 319..343 | CDD:275381 | 6/27 (22%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |