DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm2 and B0393.3

DIOPT Version :9

Sequence 1:NP_001262400.1 Gene:Kdm2 / 41090 FlyBaseID:FBgn0037659 Length:1345 Species:Drosophila melanogaster
Sequence 2:NP_497980.1 Gene:B0393.3 / 175630 WormBaseID:WBGene00007168 Length:621 Species:Caenorhabditis elegans


Alignment Length:369 Identity:76/369 - (20%)
Similarity:126/369 - (34%) Gaps:140/369 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly  1054 NQHYSSSQNLALDPTVLKIIFRYLP-QDTLVTCCSVCKVWSNAA-------------VDPDLWKK 1104
            ::...:|..|.|..::|.||..::| :|.|:....||...|::.             :|      
 Worm    27 DEFVQNSALLQLKDSILDIIVEHVPLKDRLLKLRPVCHRLSDSVKRSVKSVEFLRDELD------ 85

  Fly  1105 MNCSEHKMSASLLTAIVRRQPEHL---------ILDWTQIAKRQ-LAWLVARLPALKNLSLQNC- 1158
             .|.:.|:|..|  |:..:..:|:         :.::||.:.|| :...|.|.|.||.|.:..| 
 Worm    86 -YCDDAKISFFL--AVYGKNVQHMNYDLFRSCSLREYTQWSWRQSVISSVTRCPQLKQLDILICC 147

  Fly  1159 -------PIQAV-------------------------------LALHTC----------LCP--- 1172
                   .:|.:                               |.|..|          :|.   
 Worm   148 RHRLRDGDLQVIFKQCNQLEELRMDASYINGHCFSKAPQTLRKLELECCQTLNKQGFIGMCSRLF 212

  Fly  1173 PLQTLDLSFVRGLNDAAIRDI--------LSPPKDSRPGLSDSK----TRLRDLKVMKLAGT--- 1222
            .||||.:|.::.:::..|:.|        ||...|....::..:    .||..|..:.|.|.   
 Worm   213 KLQTLHVSLMQCIDEQLIKRIGDMKSLKNLSVVADPDQKMNQFRLAEIRRLSKLTTLCLDGVNNV 277

  Fly  1223 ------DISDVAVRYITQSLPYLRHLDLSSCQRITDAGVAQIGTSTTATARLTELNLSACR---- 1277
                  |:||::......|   :.||.||.|:.|...|::::.|    ...|..|||....    
 Worm   278 TDKFLGDLSDLSTSPAGSS---IEHLSLSFCKNIGSNGISKLKT----LPNLKSLNLDGVSKRDI 335

  Fly  1278 ----------------LVSENA-------LEHLAKCEGLIWLDL 1298
                            ||||:.       .|.:..||.|..||:
 Worm   336 STGLEAIGQAGRLERLLVSEDTYVNPKTIAEFVNTCESLRTLDI 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm2NP_001262400.1 cupin_like 231..331 CDD:304367
PRTases_typeI <394..>467 CDD:294217
zf-CXXC 670..716 CDD:251032
PHD_4 721..801 CDD:293471
F-box-like <1073..1108 CDD:289689 8/48 (17%)
leucine-rich repeat 1102..1125 CDD:275381 5/22 (23%)
leucine-rich repeat 1126..1149 CDD:275381 7/32 (22%)
leucine-rich repeat 1150..1173 CDD:275381 9/74 (12%)
AMN1 1166..>1320 CDD:187754 44/194 (23%)
leucine-rich repeat 1174..1213 CDD:275381 12/50 (24%)
leucine-rich repeat 1214..1238 CDD:275381 7/32 (22%)
leucine-rich repeat 1239..1267 CDD:275381 8/27 (30%)
leucine-rich repeat 1268..1292 CDD:275381 10/50 (20%)
leucine-rich repeat 1293..1317 CDD:275381 3/6 (50%)
B0393.3NP_497980.1 leucine-rich repeat 103..137 CDD:275381 7/33 (21%)
leucine-rich repeat 138..165 CDD:275381 5/26 (19%)
leucine-rich repeat 188..213 CDD:275381 4/24 (17%)
leucine-rich repeat 214..265 CDD:275381 12/50 (24%)
LRR 232..>389 CDD:227223 35/155 (23%)
AMN1 <262..408 CDD:187754 31/125 (25%)
leucine-rich repeat 266..296 CDD:275381 6/29 (21%)
leucine-rich repeat 297..321 CDD:275381 8/27 (30%)
leucine-rich repeat 348..373 CDD:275381 6/24 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.