Sequence 1: | NP_001262400.1 | Gene: | Kdm2 / 41090 | FlyBaseID: | FBgn0037659 | Length: | 1345 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_699181.2 | Gene: | FBXL16 / 146330 | HGNCID: | 14150 | Length: | 479 | Species: | Homo sapiens |
Alignment Length: | 406 | Identity: | 88/406 - (21%) |
---|---|---|---|
Similarity: | 141/406 - (34%) | Gaps: | 89/406 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 984 SSTRVLKKPQYVVRPASGTGSSSSSGNG-GSASATNGISNGSNQ---------------SGANSC 1032
Fly 1033 GAGNGERGTNNGGLSGSNGLGNQHYSSSQNLALDPTVLKIIFRYLPQDTLVTCCSVCKVWSNAAV 1097
Fly 1098 DPDLWKKMNCSEH-KMSASLLT-------------------------------------AIVRRQ 1124
Fly 1125 PEHLILDWTQIAKRQLAWLVARLPALKNLSLQNCPIQAVLALHTCLCPPLQTLDLSFVRGLND-- 1187
Fly 1188 -AAIRDILSPPKDSRPGLSDSKTRLRDLKVMKLAGTDISDVAVRYITQSLPYLRH-LDLSSCQRI 1250
Fly 1251 TDAGVAQIGTSTTATARLTELNLSACRLVSENALEHLAK-CEGLIWLDLRHVPQVSTQSVIRFAS 1314
Fly 1315 NSKH-------DLCVR 1323 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Kdm2 | NP_001262400.1 | cupin_like | 231..331 | CDD:304367 | |
PRTases_typeI | <394..>467 | CDD:294217 | |||
zf-CXXC | 670..716 | CDD:251032 | |||
PHD_4 | 721..801 | CDD:293471 | |||
F-box-like | <1073..1108 | CDD:289689 | 8/34 (24%) | ||
leucine-rich repeat | 1102..1125 | CDD:275381 | 5/60 (8%) | ||
leucine-rich repeat | 1126..1149 | CDD:275381 | 3/22 (14%) | ||
leucine-rich repeat | 1150..1173 | CDD:275381 | 5/22 (23%) | ||
AMN1 | 1166..>1320 | CDD:187754 | 41/165 (25%) | ||
leucine-rich repeat | 1174..1213 | CDD:275381 | 9/41 (22%) | ||
leucine-rich repeat | 1214..1238 | CDD:275381 | 5/23 (22%) | ||
leucine-rich repeat | 1239..1267 | CDD:275381 | 9/28 (32%) | ||
leucine-rich repeat | 1268..1292 | CDD:275381 | 9/24 (38%) | ||
leucine-rich repeat | 1293..1317 | CDD:275381 | 6/23 (26%) | ||
FBXL16 | NP_699181.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..62 | 13/59 (22%) | |
AMN1 | 201..413 | CDD:332986 | 50/205 (24%) | ||
leucine-rich repeat | 220..243 | CDD:275381 | 5/22 (23%) | ||
leucine-rich repeat | 244..269 | CDD:275381 | 7/31 (23%) | ||
LRR 1 | 244..266 | 6/21 (29%) | |||
LRR 2 | 267..290 | 7/39 (18%) | |||
leucine-rich repeat | 270..295 | CDD:275381 | 6/34 (18%) | ||
leucine-rich repeat | 296..321 | CDD:275381 | 9/27 (33%) | ||
LRR 3 | 319..343 | 8/23 (35%) | |||
leucine-rich repeat | 322..347 | CDD:275381 | 9/24 (38%) | ||
LRR 4 | 345..369 | 6/24 (25%) | |||
leucine-rich repeat | 348..373 | CDD:275381 | 6/25 (24%) | ||
LRR 5 | 371..395 | 5/14 (36%) | |||
leucine-rich repeat | 374..398 | CDD:275381 | 4/11 (36%) | ||
LRR 6 | 396..420 | ||||
LRR 7 | 446..470 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |