DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm2 and FBXL16

DIOPT Version :9

Sequence 1:NP_001262400.1 Gene:Kdm2 / 41090 FlyBaseID:FBgn0037659 Length:1345 Species:Drosophila melanogaster
Sequence 2:NP_699181.2 Gene:FBXL16 / 146330 HGNCID:14150 Length:479 Species:Homo sapiens


Alignment Length:406 Identity:88/406 - (21%)
Similarity:141/406 - (34%) Gaps:89/406 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   984 SSTRVLKKPQYVVRPASGTGSSSSSGNG-GSASATNGISNGSNQ---------------SGANSC 1032
            ||..:...|:....|.:|........|| |:||.|.|.....|:               :...|.
Human     2 SSPGIDGDPKPPCLPRNGLVKLPGQPNGLGAASITKGTPATKNRPCQPPPPPTLPPPSLAAPLSR 66

  Fly  1033 GAGNGERGTNNGGLSGSNGLGNQHYSSSQNLALDPTVLKIIFRYLPQDTLVTCCSVCKVWSNAAV 1097
            .|..|...|..||  .::.|...|.:....||.|..:|..:|.|...........|||.|.....
Human    67 AALAGGPCTPAGG--PASALAPGHPAERPPLATDEKILNGLFWYFSACEKCVLAQVCKAWRRVLY 129

  Fly  1098 DPDLWKKMNCSEH-KMSASLLT-------------------------------------AIVRRQ 1124
            .|..|..:....| |...::|.                                     |:.::.
Human   130 QPKFWAGLTPVLHAKELYNVLPGGEKEFVNLQGFAARGFEGFCLVGVSDLDICEFIDNYALSKKG 194

  Fly  1125 PEHLILDWTQIAKRQLAWLVARLPALKNLSLQNCPIQAVLALHTCLCPPLQTLDLSFVRGLND-- 1187
            .:.:.|..:.|....|..::.::..:..|.|..|.......|.:.|...:.:|.:|....:.|  
Human   195 VKAMSLKRSTITDAGLEVMLEQMQGVVRLELSGCNDFTEAGLWSSLSARITSLSVSDCINVADDA 259

  Fly  1188 -AAIRDILSPPKDSRPGLSDSKTRLRDLKVMKLAGTDISDVAVRYITQSLPYLRH-LDLSSCQRI 1250
             |||..:|       |.|::          :.|....::|.|:.|.|....:..| |.|.||..|
Human   260 IAAISQLL-------PNLAE----------LSLQAYHVTDTALAYFTARQGHSTHTLRLLSCWEI 307

  Fly  1251 TDAGVAQIGTSTTATARLTELNLSACRLVSENALEHLAK-CEGLIWLDLRHVPQVSTQSVIRFAS 1314
            |:.||..:   ..:...||.|:||.|..|:::.:|.:|: ...|..|||...|:: |...:.:.:
Human   308 TNHGVVNV---VHSLPNLTALSLSGCSKVTDDGVELVAENLRKLRSLDLSWCPRI-TDMALEYVA 368

  Fly  1315 NSKH-------DLCVR 1323
            ...|       |.|||
Human   369 CDLHRLEELVLDRCVR 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm2NP_001262400.1 cupin_like 231..331 CDD:304367
PRTases_typeI <394..>467 CDD:294217
zf-CXXC 670..716 CDD:251032
PHD_4 721..801 CDD:293471
F-box-like <1073..1108 CDD:289689 8/34 (24%)
leucine-rich repeat 1102..1125 CDD:275381 5/60 (8%)
leucine-rich repeat 1126..1149 CDD:275381 3/22 (14%)
leucine-rich repeat 1150..1173 CDD:275381 5/22 (23%)
AMN1 1166..>1320 CDD:187754 41/165 (25%)
leucine-rich repeat 1174..1213 CDD:275381 9/41 (22%)
leucine-rich repeat 1214..1238 CDD:275381 5/23 (22%)
leucine-rich repeat 1239..1267 CDD:275381 9/28 (32%)
leucine-rich repeat 1268..1292 CDD:275381 9/24 (38%)
leucine-rich repeat 1293..1317 CDD:275381 6/23 (26%)
FBXL16NP_699181.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62 13/59 (22%)
AMN1 201..413 CDD:332986 50/205 (24%)
leucine-rich repeat 220..243 CDD:275381 5/22 (23%)
leucine-rich repeat 244..269 CDD:275381 7/31 (23%)
LRR 1 244..266 6/21 (29%)
LRR 2 267..290 7/39 (18%)
leucine-rich repeat 270..295 CDD:275381 6/34 (18%)
leucine-rich repeat 296..321 CDD:275381 9/27 (33%)
LRR 3 319..343 8/23 (35%)
leucine-rich repeat 322..347 CDD:275381 9/24 (38%)
LRR 4 345..369 6/24 (25%)
leucine-rich repeat 348..373 CDD:275381 6/25 (24%)
LRR 5 371..395 5/14 (36%)
leucine-rich repeat 374..398 CDD:275381 4/11 (36%)
LRR 6 396..420
LRR 7 446..470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.