Sequence 1: | NP_001262400.1 | Gene: | Kdm2 / 41090 | FlyBaseID: | FBgn0037659 | Length: | 1345 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_689654.1 | Gene: | FBXL14 / 144699 | HGNCID: | 28624 | Length: | 418 | Species: | Homo sapiens |
Alignment Length: | 302 | Identity: | 67/302 - (22%) |
---|---|---|---|
Similarity: | 123/302 - (40%) | Gaps: | 81/302 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 1065 LDPTVLKIIFRYLPQDTLVTCCSVCKVWSNAAVDPDLWKKMNCSEH--KMSASLLTAI----VRR 1123
Fly 1124 QPEHLILDWTQI--AKRQLAWLVARLPALKNLSLQNCP-----------IQAVLALHTCLCPPLQ 1175
Fly 1176 TLDLSFVRGLNDAAIRDILSPPKDSRPGLSDSKTRLRDLKVMKLAG-TDISDVAVRYITQSLPYL 1239
Fly 1240 RHLDLSSCQRITDAGVAQIGTSTTATA---------------RLTE---------------LNLS 1274
Fly 1275 ACRLVSENALEHLAKCEGLIWLDLRHVPQVSTQSVIRFASNS 1316 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Kdm2 | NP_001262400.1 | cupin_like | 231..331 | CDD:304367 | |
PRTases_typeI | <394..>467 | CDD:294217 | |||
zf-CXXC | 670..716 | CDD:251032 | |||
PHD_4 | 721..801 | CDD:293471 | |||
F-box-like | <1073..1108 | CDD:289689 | 10/34 (29%) | ||
leucine-rich repeat | 1102..1125 | CDD:275381 | 6/28 (21%) | ||
leucine-rich repeat | 1126..1149 | CDD:275381 | 4/24 (17%) | ||
leucine-rich repeat | 1150..1173 | CDD:275381 | 4/33 (12%) | ||
AMN1 | 1166..>1320 | CDD:187754 | 41/182 (23%) | ||
leucine-rich repeat | 1174..1213 | CDD:275381 | 7/38 (18%) | ||
leucine-rich repeat | 1214..1238 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 1239..1267 | CDD:275381 | 9/42 (21%) | ||
leucine-rich repeat | 1268..1292 | CDD:275381 | 11/38 (29%) | ||
leucine-rich repeat | 1293..1317 | CDD:275381 | 7/24 (29%) | ||
FBXL14 | NP_689654.1 | Required for down-regulation of SNAI1 | 2..48 | 13/39 (33%) | |
F-box-like | 5..46 | CDD:403981 | 12/37 (32%) | ||
AMN1 | 90..296 | CDD:187754 | 45/211 (21%) | ||
leucine-rich repeat | 92..118 | CDD:275381 | 4/33 (12%) | ||
leucine-rich repeat | 119..142 | CDD:275381 | 6/36 (17%) | ||
LRR 1 | 144..163 | 5/18 (28%) | |||
leucine-rich repeat | 145..170 | CDD:275381 | 7/24 (29%) | ||
LRR 2 | 170..191 | 7/20 (35%) | |||
leucine-rich repeat | 171..203 | CDD:275381 | 9/31 (29%) | ||
LRR 3 | 203..225 | 2/21 (10%) | |||
leucine-rich repeat | 204..229 | CDD:275381 | 2/24 (8%) | ||
AMN1 | 228..401 | CDD:187754 | 16/51 (31%) | ||
LRR 4 | 229..250 | 8/20 (40%) | |||
leucine-rich repeat | 230..254 | CDD:275381 | 9/23 (39%) | ||
LRR 5 | 254..275 | 5/20 (25%) | |||
leucine-rich repeat | 255..280 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 281..306 | CDD:275381 | |||
leucine-rich repeat | 307..331 | CDD:275381 | |||
leucine-rich repeat | 332..357 | CDD:275381 | |||
leucine-rich repeat | 358..382 | CDD:275381 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |