DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm2 and Fbxl14

DIOPT Version :9

Sequence 1:NP_001262400.1 Gene:Kdm2 / 41090 FlyBaseID:FBgn0037659 Length:1345 Species:Drosophila melanogaster
Sequence 2:NP_598701.2 Gene:Fbxl14 / 101358 MGIID:2141676 Length:400 Species:Mus musculus


Alignment Length:302 Identity:67/302 - (22%)
Similarity:123/302 - (40%) Gaps:81/302 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  1065 LDPTVLKIIFRYLPQDTLVTCCSVCKVWSNAAVDPDLWKKMNCSEH--KMSASLLTAI----VRR 1123
            |.|.:|.:||.||..........||..|.:||....:|:.:....|  :.:.||..::    :||
Mouse     8 LFPELLAMIFGYLDVRDKGRAAQVCTAWRDAAYHKSVWRGVEAKLHLRRANPSLFPSLQARGIRR 72

  Fly  1124 QPEHLILDWTQI--AKRQLAWLVARLPALKNLSLQNCP-----------IQAVLALHTCLCPPLQ 1175
                     .||  .:|.|::::..:..:::|:|..|.           :|.:        ..|:
Mouse    73 ---------VQILSLRRSLSYVIQGMANIESLNLSGCYNLTDNGLGHAFVQEI--------GSLR 120

  Fly  1176 TLDLSFVRGLNDAAIRDILSPPKDSRPGLSDSKTRLRDLKVMKLAG-TDISDVAVRYITQSLPYL 1239
            .|:||..:.:.|:::..|..              .|:.|:|::|.| ::|::..:..|...|..|
Mouse   121 ALNLSLCKQITDSSLGRIAQ--------------YLKGLEVLELGGCSNITNTGLLLIAWGLQRL 171

  Fly  1240 RHLDLSSCQRITDAGVAQIGTSTTATA---------------RLTE---------------LNLS 1274
            :.|:|.||:.::|.|:..:...|.:.|               :||:               ||||
Mouse   172 KSLNLRSCRHLSDVGIGHLAGMTRSAAEGCLGLEQLTLQDCQKLTDLSLKHISRGLTGLRLLNLS 236

  Fly  1275 ACRLVSENALEHLAKCEGLIWLDLRHVPQVSTQSVIRFASNS 1316
            .|..:|:..|.||:....|..|:||....:|...::..|..|
Mouse   237 FCGGISDAGLLHLSHMGSLRSLNLRSCDNISDTGIMHLAMGS 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm2NP_001262400.1 cupin_like 231..331 CDD:304367
PRTases_typeI <394..>467 CDD:294217
zf-CXXC 670..716 CDD:251032
PHD_4 721..801 CDD:293471
F-box-like <1073..1108 CDD:289689 10/34 (29%)
leucine-rich repeat 1102..1125 CDD:275381 6/28 (21%)
leucine-rich repeat 1126..1149 CDD:275381 4/24 (17%)
leucine-rich repeat 1150..1173 CDD:275381 4/33 (12%)
AMN1 1166..>1320 CDD:187754 41/182 (23%)
leucine-rich repeat 1174..1213 CDD:275381 7/38 (18%)
leucine-rich repeat 1214..1238 CDD:275381 7/24 (29%)
leucine-rich repeat 1239..1267 CDD:275381 9/42 (21%)
leucine-rich repeat 1268..1292 CDD:275381 11/38 (29%)
leucine-rich repeat 1293..1317 CDD:275381 7/24 (29%)
Fbxl14NP_598701.2 Required for down-regulation of SNAI1. /evidence=ECO:0000250 2..48 13/39 (33%)
F-box-like 5..46 CDD:403981 12/37 (32%)
AMN1 90..296 CDD:187754 45/211 (21%)
leucine-rich repeat 92..118 CDD:275381 4/33 (12%)
leucine-rich repeat 119..142 CDD:275381 6/36 (17%)
LRR 1 144..163 5/18 (28%)
leucine-rich repeat 145..170 CDD:275381 7/24 (29%)
LRR 2 170..191 7/20 (35%)
leucine-rich repeat 171..203 CDD:275381 9/31 (29%)
LRR 3 203..225 2/21 (10%)
leucine-rich repeat 204..229 CDD:275381 2/24 (8%)
AMN1 228..395 CDD:187754 16/51 (31%)
LRR 4 229..250 8/20 (40%)
leucine-rich repeat 230..254 CDD:275381 9/23 (39%)
LRR 5 254..275 5/20 (25%)
leucine-rich repeat 255..280 CDD:275381 7/24 (29%)
leucine-rich repeat 281..306 CDD:275381
leucine-rich repeat 307..331 CDD:275381
leucine-rich repeat 332..357 CDD:275381
leucine-rich repeat 358..382 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.