DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm2 and fbxl4

DIOPT Version :9

Sequence 1:NP_001262400.1 Gene:Kdm2 / 41090 FlyBaseID:FBgn0037659 Length:1345 Species:Drosophila melanogaster
Sequence 2:XP_031761765.1 Gene:fbxl4 / 100490265 XenbaseID:XB-GENE-961513 Length:622 Species:Xenopus tropicalis


Alignment Length:367 Identity:86/367 - (23%)
Similarity:119/367 - (32%) Gaps:122/367 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly  1015 SATNGISNGSNQSGANSCGAGNGER-GTNNGGLSGSNGLGNQHYSSSQNLALDPTVLKIIFRYLP 1078
            |.||.:||             .|.| .||||...                .|...:::.|..:|.
 Frog   262 SLTNQLSN-------------TGIREWTNNGYFD----------------KLPYELIQFIISHLA 297

  Fly  1079 QDTLVTCCSVCKVWSNAAVDPDLWKKMNCSEHKMSASLLTAIVRRQPEHLILD--WTQIAKRQLA 1141
            ...|......||:......||                       .|..||.|.  ||.:....|.
 Frog   298 LPDLCRLAQTCKLMYQHCCDP-----------------------LQYTHLSLQPYWTNVNDNSLE 339

  Fly  1142 WLVARLPALK--NLS----------------LQNCPIQAVLALHTC--------------LCPPL 1174
            :|:.|...::  |||                |:.|..:.|.....|              :||.|
 Frog   340 YLLPRCSLVQWLNLSWTGNRGLISTSGFSRLLKVCGSELVRLELACGHFLNEACLEVIAEMCPNL 404

  Fly  1175 QTLDLSFVRGLNDAAIRDILSPPKDSRPGLSDSKTRLRDLKVMKLAGTDISDVAVRYITQSLPYL 1239
            |.|:||....|...|...|               .:|..||.:.|..|.|...|:..|....|.:
 Frog   405 QELNLSSCDKLPPQAFSHI---------------CKLSGLKRLVLYRTKIEQTALLSILNFCPEI 454

  Fly  1240 RHLDLSSCQRITDAGV--AQIGTSTTATARLTELNLSACRLVSENALEHLAK-CEGLIWLDLRHV 1301
            :||:|.||..|.|..:  :.:|..   ..:|..|:|..|:.::|..:..||. |..|..|||...
 Frog   455 QHLNLGSCVLIEDYDLVASVLGAK---CKKLRSLDLWRCKNITERGIAELASGCLLLEELDLGWC 516

  Fly  1302 P--QVSTQSVIRFASNSKHDLCVRDIKLVERRRRNSTTANRS 1341
            |  |.||...:..||.            :...|:...|||||
 Frog   517 PTLQSSTGCFVNLASK------------LPNLRKLFLTANRS 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm2NP_001262400.1 cupin_like 231..331 CDD:304367
PRTases_typeI <394..>467 CDD:294217
zf-CXXC 670..716 CDD:251032
PHD_4 721..801 CDD:293471
F-box-like <1073..1108 CDD:289689 7/34 (21%)
leucine-rich repeat 1102..1125 CDD:275381 0/22 (0%)
leucine-rich repeat 1126..1149 CDD:275381 8/24 (33%)
leucine-rich repeat 1150..1173 CDD:275381 8/54 (15%)
AMN1 1166..>1320 CDD:187754 46/172 (27%)
leucine-rich repeat 1174..1213 CDD:275381 9/38 (24%)
leucine-rich repeat 1214..1238 CDD:275381 7/23 (30%)
leucine-rich repeat 1239..1267 CDD:275381 8/29 (28%)
leucine-rich repeat 1268..1292 CDD:275381 8/24 (33%)
leucine-rich repeat 1293..1317 CDD:275381 10/25 (40%)
fbxl4XP_031761765.1 F-box-like 281..325 CDD:403981 10/82 (12%)
leucine-rich repeat 296..318 CDD:275381 4/21 (19%)
leucine-rich repeat 319..341 CDD:275381 7/21 (33%)
leucine-rich repeat 348..377 CDD:275381 5/28 (18%)
leucine-rich repeat 378..403 CDD:275381 3/24 (13%)
leucine-rich repeat 404..428 CDD:275381 9/38 (24%)
AMN1 427..606 CDD:187754 40/135 (30%)
leucine-rich repeat 429..453 CDD:275381 7/23 (30%)
leucine-rich repeat 454..481 CDD:275381 8/29 (28%)
leucine-rich repeat 482..507 CDD:275381 8/24 (33%)
leucine-rich repeat 508..535 CDD:275381 10/38 (26%)
leucine-rich repeat 536..561 CDD:275381 6/11 (55%)
leucine-rich repeat 562..587 CDD:275381
leucine-rich repeat 588..613 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.