Sequence 1: | NP_001262400.1 | Gene: | Kdm2 / 41090 | FlyBaseID: | FBgn0037659 | Length: | 1345 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_002933934.2 | Gene: | fbxl12 / 100135148 | XenbaseID: | XB-GENE-942694 | Length: | 350 | Species: | Xenopus tropicalis |
Alignment Length: | 299 | Identity: | 76/299 - (25%) |
---|---|---|---|
Similarity: | 127/299 - (42%) | Gaps: | 58/299 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 1055 QHYSSSQNLALD---PTVLKIIFRYLPQDTLVTCCSVCKVWSNAAVDPDLWKKMNCSEHKMSASL 1116
Fly 1117 LTAIVRRQ--P--EHLILDWT-QIAKRQ-------LAWLVARLPALKNLSLQNCPIQAV------ 1163
Fly 1164 -----LALHTC---------------LCPPLQTLDLSFVRGLNDAAIRDI--LSPPKD------- 1199
Fly 1200 --SRPGLSDSKTRLRDLKVMKLAGTDISDVAVRYITQSLPYLRHLDLSSCQRITDAGVAQIGTST 1262
Fly 1263 TATARLTELNLSACRLVSENALEHLAKCEGLIWLDLRHV 1301 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Kdm2 | NP_001262400.1 | cupin_like | 231..331 | CDD:304367 | |
PRTases_typeI | <394..>467 | CDD:294217 | |||
zf-CXXC | 670..716 | CDD:251032 | |||
PHD_4 | 721..801 | CDD:293471 | |||
F-box-like | <1073..1108 | CDD:289689 | 11/34 (32%) | ||
leucine-rich repeat | 1102..1125 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 1126..1149 | CDD:275381 | 7/30 (23%) | ||
leucine-rich repeat | 1150..1173 | CDD:275381 | 6/48 (13%) | ||
AMN1 | 1166..>1320 | CDD:187754 | 42/162 (26%) | ||
leucine-rich repeat | 1174..1213 | CDD:275381 | 12/49 (24%) | ||
leucine-rich repeat | 1214..1238 | CDD:275381 | 9/23 (39%) | ||
leucine-rich repeat | 1239..1267 | CDD:275381 | 8/27 (30%) | ||
leucine-rich repeat | 1268..1292 | CDD:275381 | 7/23 (30%) | ||
leucine-rich repeat | 1293..1317 | CDD:275381 | 3/9 (33%) | ||
fbxl12 | XP_002933934.2 | F-box-like | 45..88 | CDD:372399 | 13/42 (31%) |
leucine-rich repeat | 60..84 | CDD:275381 | 8/23 (35%) | ||
leucine-rich repeat | 85..107 | CDD:275381 | 6/21 (29%) | ||
leucine-rich repeat | 112..144 | CDD:275381 | 7/31 (23%) | ||
leucine-rich repeat | 145..194 | CDD:275381 | 6/48 (13%) | ||
leucine-rich repeat | 195..219 | CDD:275381 | 6/23 (26%) | ||
LRR_RI | <216..343 | CDD:393385 | 34/118 (29%) | ||
leucine-rich repeat | 220..245 | CDD:275381 | 5/24 (21%) | ||
leucine-rich repeat | 246..270 | CDD:275381 | 9/23 (39%) | ||
leucine-rich repeat | 271..295 | CDD:275381 | 7/23 (30%) | ||
leucine-rich repeat | 296..321 | CDD:275381 | 8/26 (31%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |