DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kdm2 and si:dkey-192l18.9

DIOPT Version :9

Sequence 1:NP_001262400.1 Gene:Kdm2 / 41090 FlyBaseID:FBgn0037659 Length:1345 Species:Drosophila melanogaster
Sequence 2:XP_001344855.1 Gene:si:dkey-192l18.9 / 100005961 ZFINID:ZDB-GENE-120709-25 Length:476 Species:Danio rerio


Alignment Length:476 Identity:99/476 - (20%)
Similarity:178/476 - (37%) Gaps:133/476 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   930 MHESNDAPCGSSAEGAGGAGNANVSTNQWSGSGGGGGSRKKNSIRSQLAQQMLNSSTRVLKKPQY 994
            |..:|...|.|.     |.|::::|::..|.:........||:..|:.:.|.:.:.:     |..
Zfish     1 MGANNGKQCESE-----GKGSSSISSDVSSSTEHTPSKSHKNAATSEDSDQSMRTPS-----PAL 55

  Fly   995 VVRPASGTGSSSSSGNGGSASATNGISNGSNQSGANSCGAGNGERGTNNGGLSGSNGLGNQHYSS 1059
            ::.|                :....:.||...|...:....:....|.:...       ...:::
Zfish    56 ILNP----------------NPPQTVPNGRESSLGETVALIHPPPATRSKST-------KPPHTA 97

  Fly  1060 SQNLALDPTVLKIIFRYLPQDTLVTCCSVCKVWSNAAVDPDLWK--KMN---------------- 1106
            ..::..||.:|.|: .||....|..|..||:.|.|.:.||.||.  ::|                
Zfish    98 LIDILPDPVLLHIL-SYLSTPHLCLCARVCRRWYNLSWDPRLWSTIRLNGELLNADRALKVLTHR 161

  Fly  1107 -CSE----------------HKMSASLLTAIVRRQPEHLILDWT---QIAKRQLAWLVARLPALK 1151
             |.:                .::|...|..|.|..||...|:..   .::...:..:|::.|.|:
Zfish   162 LCQDTPNVCLTLETVVASGCRRLSDRGLRVIARCCPELRCLEVAGCYNVSNDAVFDVVSKCPNLE 226

  Fly  1152 NLSLQNCPIQAVLAL-------HTCLCPPL--QTLDLSFV----------RGLNDAAI------- 1190
            :|.:..||....::|       ||    ||  |.:.|.::          :||...||       
Zfish   227 HLDVSGCPKVTCISLTEEGSVQHT----PLHGQQIGLRYLNMTDCVSLEDKGLKTIAIHCPRLTH 287

  Fly  1191 ---RDILSPPKDSRPGLSDSKTRLRDL--------------KVMKLAG----------TDISDVA 1228
               |..:....:|...|:...|.||:|              :|.:|.|          ..|:||.
Zfish   288 LYLRRCIRITDESLRQLALHCTALRELSLSDCHLVGDFGLREVARLEGRLRYLSVAHCMRITDVG 352

  Fly  1229 VRYITQSLPYLRHLDLSSCQRITDAGVAQIGTSTTATARLTELNLSACRLVSENALEHLAK-CEG 1292
            :||:.:..|.||:|:...|:.:||.|::.:..:   ..||..:::..|.|||:..||.||. |:.
Zfish   353 LRYVARYCPRLRYLNARGCEGLTDQGLSYLARN---CPRLRSIDVGRCPLVSDAGLEVLAHCCKM 414

  Fly  1293 LIWLDLRHVPQVSTQSVIRFA 1313
            |..|.||....::.:.::..|
Zfish   415 LRRLSLRGCESLTGRGLMALA 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kdm2NP_001262400.1 cupin_like 231..331 CDD:304367
PRTases_typeI <394..>467 CDD:294217
zf-CXXC 670..716 CDD:251032
PHD_4 721..801 CDD:293471
F-box-like <1073..1108 CDD:289689 13/53 (25%)
leucine-rich repeat 1102..1125 CDD:275381 7/57 (12%)
leucine-rich repeat 1126..1149 CDD:275381 3/25 (12%)
leucine-rich repeat 1150..1173 CDD:275381 7/29 (24%)
AMN1 1166..>1320 CDD:187754 50/202 (25%)
leucine-rich repeat 1174..1213 CDD:275381 12/60 (20%)
leucine-rich repeat 1214..1238 CDD:275381 9/47 (19%)
leucine-rich repeat 1239..1267 CDD:275381 7/27 (26%)
leucine-rich repeat 1268..1292 CDD:275381 10/24 (42%)
leucine-rich repeat 1293..1317 CDD:275381 5/21 (24%)
si:dkey-192l18.9XP_001344855.1 F-box-like 99..145 CDD:289689 16/46 (35%)
leucine-rich repeat 114..138 CDD:275381 9/23 (39%)
leucine-rich repeat 139..172 CDD:275381 3/32 (9%)
leucine-rich repeat 173..198 CDD:275381 4/24 (17%)
leucine-rich repeat 199..220 CDD:275381 1/20 (5%)
LRR_CC 222..246 CDD:197685 6/23 (26%)
leucine-rich repeat 225..258 CDD:275381 10/36 (28%)
leucine-rich repeat 259..284 CDD:275381 5/24 (21%)
AMN1 280..465 CDD:187754 40/159 (25%)
leucine-rich repeat 285..310 CDD:275381 3/24 (13%)
leucine-rich repeat 311..336 CDD:275381 5/24 (21%)
leucine-rich repeat 337..362 CDD:275381 5/24 (21%)
leucine-rich repeat 363..388 CDD:275381 7/27 (26%)
leucine-rich repeat 389..414 CDD:275381 10/24 (42%)
leucine-rich repeat 415..440 CDD:275381 5/21 (24%)
leucine-rich repeat 441..465 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.