DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGEA10 and MAGE

DIOPT Version :9

Sequence 1:NP_001011543.3 Gene:MAGEA10 / 4109 HGNCID:6797 Length:369 Species:Homo sapiens
Sequence 2:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster


Alignment Length:227 Identity:58/227 - (25%)
Similarity:108/227 - (47%) Gaps:20/227 - (8%)


- Green bases have known domain annotations that are detailed below.


Human   109 SSSQKEESPSTLQVLPDSES-LPRSEIDEKVTDLVQFLLFKYQMKEPITKAEIL-----ESVIRN 167
            |:|:...|.:   .:|..|: .|...:|.||..::.::|.....|.||...:::     :|.::.
  Fly     3 STSRAARSQN---AIPSQEAQQPVDVVDAKVRAILNYILDHTAQKIPIKDKDLIAVAGDKSELKK 64

Human   168 YEDHFPLLFSEASECMLLVFGIDVKEVDPTGHSFVLVTSLGLTYDGMLSDVQSMPKTGILILILS 232
               ..||:.:..:|    .|||.:..:|.|..:|:......:.....|:..| .|:..:|.:||.
  Fly    65 ---RLPLVTNLLAE----TFGIILTPLDATTKTFICTAEEPVASIHELTPAQ-RPQFTLLYIILM 121

Human   233 IVFIEGYCTPEEVIWEALNMMGLYDGMEHLIYG-EPRKLLTQDWVQENYL--EYRQVPGSDPARY 294
            .:|:.|....:..::..|.|:.:|...||..:| ..||.:.:.:|::.||  |..|:...|.::.
  Fly   122 YIFLRGNRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRERSQLSAYDDSKT 186

Human   295 EFLWGPRAHAEIRKMSLLKFLAKVNGSDPRSF 326
            .|||||||.||.....:::|.:|:....|:.|
  Fly   187 FFLWGPRAKAEFTFEQMVQFASKLLNQHPKVF 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGEA10NP_001011543.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..131 5/22 (23%)
MAGE_N 6..116 CDD:403589 2/6 (33%)
MAGE 141..306 CDD:396164 44/172 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 340..369
MAGENP_649702.2 MAGE 36..201 CDD:279759 45/172 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151953
Domainoid 1 1.000 63 1.000 Domainoid score I10231
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5087
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 1 1.000 - - FOG0000171
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.