DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rel and rela

DIOPT Version :9

Sequence 1:NP_477094.1 Gene:Rel / 41087 FlyBaseID:FBgn0014018 Length:971 Species:Drosophila melanogaster
Sequence 2:XP_005170853.1 Gene:rela / 415099 ZFINID:ZDB-GENE-040825-4 Length:588 Species:Danio rerio


Alignment Length:395 Identity:129/395 - (32%)
Similarity:188/395 - (47%) Gaps:78/395 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 YHQNGLASDGDIKHVPQ----LRIVEQPVEK-FRFRYKSEMHGTHGSLNGANSKRTPKTFPEVTL 194
            :||.|.:      .|||    :.|:|||..: .|||||.|.... ||:.|..|..|.||.|.:.:
Zfish     5 FHQWGTS------QVPQGPPHVEIIEQPKSRGMRFRYKCEGRSA-GSIPGEKSNDTTKTHPAIRV 62

  Fly   195 CNYDGPAVIRCSLFQTNLD-SPHSHQLVVRKDDRDVCDPHDLHVSKERGYVAQFINMGIIHTAKK 258
            .||.||..:|.||...|.. .||.|:| |.||.:......||   :|| .:..|.|:||      
Zfish    63 HNYSGPVRVRISLVTKNQPYKPHPHEL-VGKDCKHGYYEADL---QER-RIHSFQNLGI------ 116

  Fly   259 YIFEELCKKKQD-------RLVFQMNRRELSHKQLQELHQETEREAKDMNLNQVRLCFEAFKIED 316
                 .|.||:|       ||..|.|..::...::.|         ::.:||.|||||:......
Zfish   117 -----QCVKKKDVGEAVSCRLQTQNNPFKIPDAKIWE---------EEFDLNAVRLCFQVSITLS 167

  Fly   317 NGAWVPLAP----PVYSNAINNRKSAQTGELRIVRLSKPTGGVMGNDELILLVEKVSKKNIKVRF 377
            :|...||.|    |:|.|     ::..|.||:|.|:::.:|...|.||:.||.:||.|::|:|||
Zfish   168 SGDLFPLEPVVSQPIYDN-----RAPNTAELKICRVNRNSGSCRGGDEIFLLCDKVQKEDIEVRF 227

  Fly   378 FEEDEDGETVWEAYAKFRESDVHHQYAIVCQTPPYKDKDVDREVNVYIELIRPSDDERSFPALPF 442
            |.:.      ||:...|.::|||.|.|||.:||||.|.::...:.|.::|.||||.|.|.| :.|
Zfish   228 FLDS------WESKGSFSQADVHRQVAIVFRTPPYCDTNLTEPLRVKMQLRRPSDREVSEP-MDF 285

  Fly   443 RYKP-----RSVIVSRKRRR------------TGSSANSSSSGTESSNNSLDLPKTLGLAQPPNG 490
            :|.|     ..::..|||..            ||||.::......::..:|.:.|....|..|..
Zfish   286 QYLPSDPDEHRLMEKRKRTEGMLHNLKLSSIITGSSMSAERRPFPTAKRTLPVSKQPVAASAPAS 350

  Fly   491 LPNLS 495
            :|.:|
Zfish   351 VPAVS 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RelNP_477094.1 RHD-n_Relish 150..336 CDD:143644 66/202 (33%)
IPT_NFkappaB 343..446 CDD:238582 43/102 (42%)
ANK 638..766 CDD:238125
ANK repeat 640..671 CDD:293786
Ank_4 641..691 CDD:290365
ANK repeat 673..708 CDD:293786
Ank_2 678..775 CDD:289560
relaXP_005170853.1 RHD-n_RelA 18..186 CDD:143645 64/198 (32%)
IPT_NFkappaB 193..289 CDD:238582 43/102 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D391433at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24169
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.