DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rel and Rela

DIOPT Version :9

Sequence 1:NP_477094.1 Gene:Rel / 41087 FlyBaseID:FBgn0014018 Length:971 Species:Drosophila melanogaster
Sequence 2:NP_954888.1 Gene:Rela / 309165 RGDID:727889 Length:550 Species:Rattus norvegicus


Alignment Length:509 Identity:145/509 - (28%)
Similarity:213/509 - (41%) Gaps:144/509 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 PQLRIVEQPVEK-FRFRYKSEMHGTHGSLNGANSKRTPKTFPEVTLCNYDGPAVIRCSLFQTN-L 212
            |.:.|:|||.:: .|||||.|.... ||:.|..|..|.||.|.:.:..|.||..:|.||...: .
  Rat    19 PYVEIIEQPKQRGMRFRYKCEGRSA-GSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPP 82

  Fly   213 DSPHSHQLVVRKDDRD------VCDPHDLHVSKERGYVAQFINMGIIHTAKKYIFEELCKKKQDR 271
            ..||.|:| |.||.||      :|....:|         .|.|:||           .|.||:|.
  Rat    83 HRPHPHEL-VGKDCRDGFYEAELCPDRCIH---------SFQNLGI-----------QCVKKRDL 126

  Fly   272 LVFQMNRRELSHKQLQELHQETEREAKDMNLNQVRLCFEAFKIEDNGAWVPLAPPVYSNAINNRK 336
            ......|.:.::...|   ...|.:..|.:||.|||||:....:.:|..:.|. ||.|:.|.:.:
  Rat   127 EQAISQRIQTNNNPFQ---VPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLT-PVLSHPIFDNR 187

  Fly   337 SAQTGELRIVRLSKPTGGVMGNDELILLVEKVSKKNIKVRFFEEDEDGETVWEAYAKFRESDVHH 401
            :..|.||:|.|:::.:|..:|.||:.||.:||.|::|:|.|....      |||...|.::|||.
  Rat   188 APNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPG------WEARGSFSQADVHR 246

  Fly   402 QYAIVCQTPPYKDKDVDREVNVYIELIRPSDDERSFPALPFRYKPRS---VIVSRKRRRTGSS-- 461
            |.|||.:||||.|..:...|.|.::|.||||.|.|.| :.|:|.|.:   ..:..||:||..:  
  Rat   247 QVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEP-MEFQYLPDTDDRHRIEEKRKRTYETFK 310

  Fly   462 ---------------------------------------ANSSSSGT--------------ESSN 473
                                                   |.|:|..|              :.||
  Rat   311 SIMKKSPFNGPTEPRPPPRRIAVPSRGPTSVPKPAPQPYAFSTSLSTINFDEFSPMVLPPGQISN 375

  Fly   474 NSLDL-------------PKTL---GLAQPPNGLPNLS----------------QHDQTISEEFG 506
            .:|.|             |.:.   .|||||..:|.|:                ..:.|:||.. 
  Rat   376 QALALAPSSAPVLAQTMVPSSAMVPSLAQPPAPVPVLAPGPPQSLSAPVPKSTQAGEGTLSEAL- 439

  Fly   507 REKHLNEFIASEDFRKLIEHNS-----SDLEKICQLDMGELQHDG----HNRAE 551
              .|| :|.|.||...|:.:|:     :||..:...:..:|.:.|    |:.||
  Rat   440 --LHL-QFDADEDLGALLGNNTDPGVFTDLASVDNSEFQQLLNQGVAMSHSTAE 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RelNP_477094.1 RHD-n_Relish 150..336 CDD:143644 61/193 (32%)
IPT_NFkappaB 343..446 CDD:238582 43/102 (42%)
ANK 638..766 CDD:238125
ANK repeat 640..671 CDD:293786
Ank_4 641..691 CDD:290365
ANK repeat 673..708 CDD:293786
Ank_2 678..775 CDD:289560
RelaNP_954888.1 RHD-n_RelA 19..187 CDD:143645 61/193 (32%)
IPT_NFkappaB 194..290 CDD:238582 43/102 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D391433at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24169
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.980

Return to query results.
Submit another query.