DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rel and Rela

DIOPT Version :9

Sequence 1:NP_477094.1 Gene:Rel / 41087 FlyBaseID:FBgn0014018 Length:971 Species:Drosophila melanogaster
Sequence 2:XP_006531757.1 Gene:Rela / 19697 MGIID:103290 Length:556 Species:Mus musculus


Alignment Length:539 Identity:148/539 - (27%)
Similarity:217/539 - (40%) Gaps:158/539 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 YFVPAPATVPPSQNFGYHQNGLASDGDIKHVPQLRIVEQPVEK-FRFRYKSEMHGTHGSLNGANS 182
            |..|......|:|..|               |.:.|:|||.:: .|||||.|.... ||:.|..|
Mouse    10 YLFPLIFPSEPAQASG---------------PYVEIIEQPKQRGMRFRYKCEGRSA-GSIPGERS 58

  Fly   183 KRTPKTFPEVTLCNYDGPAVIRCSLFQTN-LDSPHSHQLVVRKDDR------DVCDPHDLHVSKE 240
            ..|.||.|.:.:..|.||..:|.||...: ...||.|:| |.||.|      |:|....:|    
Mouse    59 TDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHEL-VGKDCRDGYYEADLCPDRSIH---- 118

  Fly   241 RGYVAQFINMGIIHTAKKYIFEELCKKKQDRLVFQMNRRELSHKQLQELHQETEREAKDMNLNQV 305
                 .|.|:||           .|.||:| |...:::|..::.  ...|...|.:..|.:||.|
Mouse   119 -----SFQNLGI-----------QCVKKRD-LEQAISQRIQTNN--NPFHVPIEEQRGDYDLNAV 164

  Fly   306 RLCFEAFKIEDNGAWVPLAPPVYSNAINNRKSAQTGELRIVRLSKPTGGVMGNDELILLVEKVSK 370
            ||||:. .:.|......|..||.|:.|.:.::..|.||:|.|:::.:|..:|.||:.||.:||.|
Mouse   165 RLCFQV-TVRDPAGRPLLLTPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQK 228

  Fly   371 KNIKVRFFEEDEDGETVWEAYAKFRESDVHHQYAIVCQTPPYKDKDVDREVNVYIELIRPSDDER 435
            ::|:|.|....      |||...|.::|||.|.|||.:||||.|..:...|.|.::|.||||.|.
Mouse   229 EDIEVYFTGPG------WEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDREL 287

  Fly   436 SFPALPFRYKPRS---VIVSRKRRRTGSSANS------SSSGTE----------SSNNSLDLPK- 480
            |.| :.|:|.|.:   ..:..||:||..:..|      .:..||          .:.||..:|| 
Mouse   288 SEP-MEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFNGPTEPRPPTRRIAVPTRNSTSVPKP 351

  Fly   481 -----------------------------------------------------TLGLAQPPNGLP 492
                                                                 .:.|||||...|
Mouse   352 APQPYTFPASLSTINFDEFSPMLLPSGQISNQALALAPSSAPVLAQTMVPSSAMVPLAQPPAPAP 416

  Fly   493 NLS----------------QHDQTISEEFGREKHLNEFIASEDFRKLIEHNS-----SDLEKICQ 536
            .|:                ..:.|:||..   .|| :|.|.||...|:.:::     :||..:..
Mouse   417 VLTPGPPQSLSAPVPKSTQAGEGTLSEAL---LHL-QFDADEDLGALLGNSTDPGVFTDLASVDN 477

  Fly   537 LDMGELQHDG----HNRAE 551
            .:..:|.:.|    |:.||
Mouse   478 SEFQQLLNQGVSMSHSTAE 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RelNP_477094.1 RHD-n_Relish 150..336 CDD:143644 62/193 (32%)
IPT_NFkappaB 343..446 CDD:238582 43/102 (42%)
ANK 638..766 CDD:238125
ANK repeat 640..671 CDD:293786
Ank_4 641..691 CDD:290365
ANK repeat 673..708 CDD:293786
Ank_2 678..775 CDD:289560
RelaXP_006531757.1 RHD-n_RelA 26..194 CDD:143645 62/193 (32%)
IPT_NFkappaB 201..297 CDD:238582 43/102 (42%)
PHA03247 <262..528 CDD:223021 52/240 (22%)
DUF5364 <451..539 CDD:375130 11/46 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D391433at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24169
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.980

Return to query results.
Submit another query.