DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rel and Relb

DIOPT Version :9

Sequence 1:NP_477094.1 Gene:Rel / 41087 FlyBaseID:FBgn0014018 Length:971 Species:Drosophila melanogaster
Sequence 2:XP_008757276.1 Gene:Relb / 100360982 RGDID:2321078 Length:559 Species:Rattus norvegicus


Alignment Length:394 Identity:135/394 - (34%)
Similarity:181/394 - (45%) Gaps:59/394 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 PAPATVPPSQNFGYHQNGLASDGDIKHVPQLRIVEQPVEK-FRFRYKSEMHGTHGSLNGANSKRT 185
            |.|||.|.:...|    .|.|.|.... |.|.|.|||.:: .||||:.|.... ||:.|.:|...
  Rat    81 PPPATPPWNCTLG----RLVSPGPCPR-PYLVITEQPKQRGMRFRYECEGRSA-GSILGESSTEA 139

  Fly   186 PKTFPEVTLCNYDG---PAVIRCSLFQTNLDSPHSHQLVVRKDDRDVC----DPHDLHVSKERGY 243
            .||.|.:.|.:..|   ..|..|.:::......|.|.||.:.....||    .|   |||...  
  Rat   140 SKTLPAIELRDCGGLREVEVTACLVWKDWPHRVHPHSLVGKDCTDGVCRVRLRP---HVSPRH-- 199

  Fly   244 VAQFINMGIIHTAKKYIFEELCKKKQDRLVFQMNRRELSHKQLQELHQETEREAKDMNLNQVRLC 308
              .|.|:||....||.| |...::|....:...|...|.:      |||.     |||:  ||:|
  Rat   200 --SFNNLGIQCVRKKEI-EAAIERKIQLGIDPYNAGSLKN------HQEV-----DMNV--VRIC 248

  Fly   309 FEAFKIEDNGAWVPLAPPVYSNAINNRKSAQTGELRIVRLSKPTGGVMGNDELILLVEKVSKKNI 373
            |:| ...|....:....|:.|..:.::||..|.||||.|::|.:|...|.:||.||.:||.|::|
  Rat   249 FQA-SYRDQQGHLHRMDPILSEPVYDKKSTNTSELRICRINKESGPCTGGEELYLLCDKVQKEDI 312

  Fly   374 KVRFFEEDEDGETVWEAYAKFRESDVHHQYAIVCQTPPYKDKDVDREVNVYIELIRPSDDERSFP 438
            .|.|      ....||..|.|.::|||.|.|||.:||||:|.::...|.|.:.|.|.:|...|.|
  Rat   313 SVVF------STASWEGRADFSQADVHRQIAIVFKTPPYEDLEISEPVTVNVFLQRLTDGVCSEP 371

  Fly   439 ALPFRYKPR---SVIVSRKRRR-----TGSSANSSSSGTESSNNS-----LD--LP-KTLGLAQP 487
             |||.|.||   |..|.:||:|     .|..::|...|.||....     ||  || .:.||..|
  Rat   372 -LPFTYLPRDHDSYGVDKKRKRGLPDVLGELSSSDPHGIESKRRKKKPVFLDHFLPGHSSGLFLP 435

  Fly   488 PNGL 491
            |:.|
  Rat   436 PSAL 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RelNP_477094.1 RHD-n_Relish 150..336 CDD:143644 57/193 (30%)
IPT_NFkappaB 343..446 CDD:238582 44/102 (43%)
ANK 638..766 CDD:238125
ANK repeat 640..671 CDD:293786
Ank_4 641..691 CDD:290365
ANK repeat 673..708 CDD:293786
Ank_2 678..775 CDD:289560
RelbXP_008757276.1 RelB_leu_zip 1..76 CDD:292798
RHD-n_RelB 104..275 CDD:143646 57/193 (30%)
RHD_dimer 283..379 CDD:292797 43/102 (42%)
RelB_transactiv 382..559 CDD:292799 19/58 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D391433at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24169
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.980

Return to query results.
Submit another query.