DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hyx and CG6220

DIOPT Version :9

Sequence 1:NP_001163564.1 Gene:hyx / 41086 FlyBaseID:FBgn0037657 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_610897.1 Gene:CG6220 / 36520 FlyBaseID:FBgn0033865 Length:359 Species:Drosophila melanogaster


Alignment Length:383 Identity:124/383 - (32%)
Similarity:192/383 - (50%) Gaps:55/383 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 MDNI-KSLSETMSVEKIAAIKAKRLANKRTTIKRTDNDEAMGTDLRAILDYDVDSTKDI----IS 226
            ||.| |:|:|||:||.||.|||||||.|::..|......|...:....||   :..|::    :.
  Fly     1 MDPILKTLTETMTVEAIAIIKAKRLAMKQSVDKNAMQMRAQEREKGRNLD---NMQKELGRRAMK 62

  Fly   227 RERQWRT-RTSILQSTGKIFAKNIFAMLQGIKAREEGRNRPQVPNPIKMPEPARI--AKPQPQLS 288
            |||..|. ...:|.......|:....:......|......|:: :.::||.|..|  ..|.|: :
  Fly    63 RERPCRVFEEQLLGEKEMTTAQEYLKLAHHSMMRSLDSTVPEL-SQLEMPPPPEIMTEPPWPK-T 125

  Fly   289 QYNRYDQERFNRQKEE----TEGFKIDTLGTYHGMSL----KSVTEGSLAQRKAQANNLPGAPGV 345
            :||||.||:|.:.::|    .:|..::...|:|....    :||:..|:.:.::.:.:       
  Fly   126 KYNRYGQEKFLKAQQEFGINPQGSNLENCATFHESQKDKRNRSVSRESIERSRSNSKD------- 183

  Fly   346 IAGAAAGRPKELLPAAQARQLPANGPSKRTSRTPIIIIPSANTSLITMLNAKDILQELRFMSTSD 410
                                   ...||..:|.|||::|.|.||:|::.|.|.:|:||.:....:
  Fly   184 -----------------------RRSSKLYARMPIIVVPDAMTSMISLNNIKTLLEELHYEPERN 225

  Fly   411 KKLQGCQREC---EVLLQRKRNNQTVSYRVIDNPTKLSQQEWQRVVAVFVMGPQWQFKGWPWEGN 472
            .: |....||   ||:::.:..|:.||||||||.|.|:..||.||||||.|||:|||||||...:
  Fly   226 GR-QSNPPECRPKEVIVEHRFQNELVSYRVIDNVTNLTPVEWDRVVAVFAMGPKWQFKGWPDGAD 289

  Fly   473 PVDIFSKICAFHLCFSEMKLDSNVERWSVTLLRLSQNKRHMDRAVLSKFWETLDKYIA 530
            |..||.|:|||||.|....:...:.:..|..|.||..:||.|..::.:||..:|:::|
  Fly   290 PAAIFHKVCAFHLHFRNTPMCPELTKLQVHSLALSPTERHSDSGIIMEFWNRVDRHMA 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hyxNP_001163564.1 CDC73_N 1..297 CDD:292669 44/137 (32%)
CDC73_C 376..527 CDD:282965 67/153 (44%)
CG6220NP_610897.1 CDC73_N <5..134 CDD:292669 41/133 (31%)
CDC73_C 190..344 CDD:282965 67/154 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462126
Domainoid 1 1.000 118 1.000 Domainoid score I1938
eggNOG 1 0.900 - - E1_COG5157
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D384163at33208
OrthoFinder 1 1.000 - - FOG0004392
OrthoInspector 1 1.000 - - otm3413
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12466
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.