DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment neur and AT4G20160

DIOPT Version :9

Sequence 1:NP_476652.1 Gene:neur / 41085 FlyBaseID:FBgn0002932 Length:754 Species:Drosophila melanogaster
Sequence 2:NP_001328820.1 Gene:AT4G20160 / 827762 AraportID:AT4G20160 Length:1213 Species:Arabidopsis thaliana


Alignment Length:84 Identity:31/84 - (36%)
Similarity:46/84 - (54%) Gaps:9/84 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   670 IEQPIANSTNNAANKWKDSLSDQQSTDSSAECTICYENPIDSVLYMCGHMCMCYDCAIE-QWRGV 733
            :.|.::.|.::|..:     .|.:......:|.:|.|.|:||:||.|||||.|..||.| ||   
plant  1135 VTQDLSRSGSSAEQR-----VDPKKDPLKRKCCVCSEMPVDSLLYRCGHMCTCLKCAHELQW--- 1191

  Fly   734 GGGQCPLCRAVIRDVIRTY 752
            ...:||:|.|.|.||:|.:
plant  1192 SSKKCPICMAPIVDVVRAF 1210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
neurNP_476652.1 NEUZ 106..225 CDD:128856
SPRY 108..255 CDD:295394
Neuralized 109..173 CDD:284568
NEUZ 367..489 CDD:128856
SPRY 371..519 CDD:295394
Neuralized 371..436 CDD:284568
zf-C3HC4_3 700..748 CDD:290631 24/48 (50%)
AT4G20160NP_001328820.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 61 1.000 Domainoid score I3804
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2868
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.