| Sequence 1: | NP_476652.1 | Gene: | neur / 41085 | FlyBaseID: | FBgn0002932 | Length: | 754 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001076443.1 | Gene: | Neurl2 / 415115 | MGIID: | 3043305 | Length: | 285 | Species: | Mus musculus |
| Alignment Length: | 241 | Identity: | 55/241 - (22%) |
|---|---|---|---|
| Similarity: | 86/241 - (35%) | Gaps: | 87/241 - (36%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 93 RSPSSCPGPNNLPPLQFHSVHGDNIRISRDGTLARRFESFCRAITFSARPVRINERICVKFAEIS 157
Fly 158 NNWNGGIRFGFTSNDPVTLEGTLPKYACPDLT--------------------------------- 189
Fly 190 ------------------------NRPGFWAKALHEQY------------------CEKDNILYY 212
Fly 213 YVNGAGDVIYGINNEEKGVILTGIDTRSLLWTVIDIYGNCTGIEFL 258 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| neur | NP_476652.1 | NEUZ | 106..225 | CDD:128856 | 41/193 (21%) |
| SPRY | 108..255 | CDD:295394 | 48/221 (22%) | ||
| Neuralized | 109..173 | CDD:284568 | 25/63 (40%) | ||
| NEUZ | 367..489 | CDD:128856 | |||
| SPRY | 371..519 | CDD:295394 | |||
| Neuralized | 371..436 | CDD:284568 | |||
| zf-C3HC4_3 | 700..748 | CDD:290631 | |||
| Neurl2 | NP_001076443.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..28 | 8/17 (47%) | |
| SPRY_NHR_like | 25..242 | CDD:293945 | 48/224 (21%) | ||
| SOCS_box | 249..285 | CDD:198037 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG4625 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||