DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment neur and Neurl3

DIOPT Version :9

Sequence 1:NP_476652.1 Gene:neur / 41085 FlyBaseID:FBgn0002932 Length:754 Species:Drosophila melanogaster
Sequence 2:XP_006495909.1 Gene:Neurl3 / 214854 MGIID:2429944 Length:268 Species:Mus musculus


Alignment Length:331 Identity:86/331 - (25%)
Similarity:119/331 - (35%) Gaps:112/331 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 LQFH-SVHGDNIRISRDGTLARRFESFCRAITFSARPVRINERICVKFAEISNNWNGGIRFGFTS 170
            |.|| :..|..:.:....:.|||..:|...|.||.|||...||:.::.......|.||:|.|||.
Mouse    32 LSFHGNATGAQVHLDDQRSTARRRSTFHDGIVFSQRPVWPGERVALRVLRHEEGWCGGLRVGFTR 96

  Fly   171 NDPVTLEGT-LPKYACPDLTNRPGFWAKALHEQYCEKDNILYYYVNGAGDVIYGINNE-----EK 229
            .||..:..: ||.:.||||..:...||..|.|.:....|::.::||..|.:...:|..     .|
Mouse    97 LDPAQVAASCLPPFVCPDLEEQSPTWAALLPEGFVRAGNVVCFWVNRRGWLFAKVNAGRPLLLRK 161

  Fly   230 GVILTGIDTRSLLWTVIDIYGNCTGIEFLDSRIYMYQQQPAAIPMATVPAQQQQMPQPAANASSA 294
            .|::.|    :.||.|:|:||....||.||                           |.|||  .
Mouse   162 DVLVQG----APLWAVMDVYGTTKAIELLD---------------------------PKANA--W 193

  Fly   295 LNSHHPHQQSRRSLPGHTAAIEHDLERHVMPSLQSLHLAGNGGSVASVEQAAIAHDLANGLPPLR 359
            :.|..|..:|                                 .|.|.|:..|.           
Mouse   194 IRSGEPVPES---------------------------------EVISGEECVIC----------- 214

  Fly   360 YNANGRLIPVPFHNTKGRNVRL---SQDRFVASRTESDFCQGYVF--TAR-PI---RIGEKLIVQ 415
                       ||||  .|.||   ....|..|      |..::|  ||| ||   :|.|..:|.
Mouse   215 -----------FHNT--ANTRLMPCGHSHFCGS------CAWHIFKDTARCPICRWQIEEVAVVS 260

  Fly   416 VLKTEQ 421
            .||.|:
Mouse   261 SLKAEE 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
neurNP_476652.1 NEUZ 106..225 CDD:128856 39/119 (33%)
SPRY 108..255 CDD:295394 48/153 (31%)
Neuralized 109..173 CDD:284568 22/64 (34%)
NEUZ 367..489 CDD:128856 22/64 (34%)
SPRY 371..519 CDD:295394 22/60 (37%)
Neuralized 371..436 CDD:284568 22/60 (37%)
zf-C3HC4_3 700..748 CDD:290631
Neurl3XP_006495909.1 Neuralized 34..187 CDD:369249 50/156 (32%)
RING-HC_NEURL3 209..250 CDD:319466 18/70 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001576
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12429
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.