DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment neur and NEURL2

DIOPT Version :9

Sequence 1:NP_476652.1 Gene:neur / 41085 FlyBaseID:FBgn0002932 Length:754 Species:Drosophila melanogaster
Sequence 2:NP_542787.1 Gene:NEURL2 / 140825 HGNCID:16156 Length:285 Species:Homo sapiens


Alignment Length:246 Identity:55/246 - (22%)
Similarity:84/246 - (34%) Gaps:92/246 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 FGLVRRSPSSCPGPNNLPPLQFHSVHGDNIRISRDGTLARRFESFCRAITFSARPVRINERICVK 152
            :||.|..|         ||.:||.|||.|||:...||.|.|.|||...:.||..|:...:...|:
Human    14 WGLERPEP---------PPTRFHRVHGANIRVDPSGTRATRVESFAHGVCFSREPLAPGQVFLVE 69

  Fly   153 FAEISNNWNGGIRFGFTSNDPVTLEGTLPKYACPDLTN--------------------------- 190
            ..|....|.|.:|.|.|:.||.:| ..:|:::.|||.|                           
Human    70 IEEKELGWCGHLRLGLTALDPASL-APVPEFSLPDLVNLGHTWVFAITRHHNRVPREGRPEAEAA 133

  Fly   191 ------------------------------RPGFWAKALHEQY------------------CEKD 207
                                          |||.::..|.:.|                  |.:.
Human   134 APSRPPTLLVEPYLRIEQFRIPRDRLVGRSRPGLYSHLLDQLYELNVLPPTARRSRLGVLFCPRP 198

  Fly   208 NILYYYVNGAGDVIYGINNEEKGVILTGIDTRSLLWTVIDIYGNCTGIEFL 258
                   :|..|:...||.|:.|....|:.....|:.|:|::.:...:..:
Human   199 -------DGTADMHIIINGEDMGPSARGLPAAQPLYAVVDVFASTKSVRLV 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
neurNP_476652.1 NEUZ 106..225 CDD:128856 42/193 (22%)
SPRY 108..255 CDD:295394 49/221 (22%)
Neuralized 109..173 CDD:284568 25/63 (40%)
NEUZ 367..489 CDD:128856
SPRY 371..519 CDD:295394
Neuralized 371..436 CDD:284568
zf-C3HC4_3 700..748 CDD:290631
NEURL2NP_542787.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 3/5 (60%)
SPRY_NHR_like 25..242 CDD:293945 49/224 (22%)
SOCS_box 249..285 CDD:198037
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.