Sequence 1: | NP_476652.1 | Gene: | neur / 41085 | FlyBaseID: | FBgn0002932 | Length: | 754 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_542787.1 | Gene: | NEURL2 / 140825 | HGNCID: | 16156 | Length: | 285 | Species: | Homo sapiens |
Alignment Length: | 246 | Identity: | 55/246 - (22%) |
---|---|---|---|
Similarity: | 84/246 - (34%) | Gaps: | 92/246 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 88 FGLVRRSPSSCPGPNNLPPLQFHSVHGDNIRISRDGTLARRFESFCRAITFSARPVRINERICVK 152
Fly 153 FAEISNNWNGGIRFGFTSNDPVTLEGTLPKYACPDLTN--------------------------- 190
Fly 191 ------------------------------RPGFWAKALHEQY------------------CEKD 207
Fly 208 NILYYYVNGAGDVIYGINNEEKGVILTGIDTRSLLWTVIDIYGNCTGIEFL 258 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
neur | NP_476652.1 | NEUZ | 106..225 | CDD:128856 | 42/193 (22%) |
SPRY | 108..255 | CDD:295394 | 49/221 (22%) | ||
Neuralized | 109..173 | CDD:284568 | 25/63 (40%) | ||
NEUZ | 367..489 | CDD:128856 | |||
SPRY | 371..519 | CDD:295394 | |||
Neuralized | 371..436 | CDD:284568 | |||
zf-C3HC4_3 | 700..748 | CDD:290631 | |||
NEURL2 | NP_542787.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..20 | 3/5 (60%) | |
SPRY_NHR_like | 25..242 | CDD:293945 | 49/224 (22%) | ||
SOCS_box | 249..285 | CDD:198037 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4625 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |