DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kcmf1 and STMN4

DIOPT Version :9

Sequence 1:NP_001163560.1 Gene:Kcmf1 / 41082 FlyBaseID:FBgn0037655 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_005273709.1 Gene:STMN4 / 81551 HGNCID:16078 Length:258 Species:Homo sapiens


Alignment Length:131 Identity:26/131 - (19%)
Similarity:57/131 - (43%) Gaps:19/131 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   389 QPTFTEAEWAVVESMRA---DRSMFVQSLMLSMLCTEALD----LNAS-----DESLAKSDNVNK 441
            |....:..|.|:..|..   ::....||..: :|...:.|    .|||     |.||.:.....:
Human    63 QADTVDLNWCVISDMEVIELNKCTSGQSFEV-ILKPPSFDGVPEFNASLPRRRDPSLEEIQKKLE 126

  Fly   442 GQQQQQEDAEAEAQAETLLNNNADVEQQQQQQQLQPAMVRQVNQMQQTSPEDFVCDEYRYKNKKA 506
            ..:::::..|||     ||.:.|: :::.:::.:|.|:....|.::....:.....|...:|::|
Human   127 AAEERRKYQEAE-----LLKHLAE-KREHEREVIQKAIEENNNFIKMAKEKLAQKMESNKENREA 185

  Fly   507 N 507
            :
Human   186 H 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kcmf1NP_001163560.1 ZZ_PCMF_like 7..55 CDD:239078
zf-Di19 76..137 CDD:310299
STMN4XP_005273709.1 Stathmin 80..201 CDD:279209 22/114 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1280
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.