DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kcmf1 and Stmn2

DIOPT Version :9

Sequence 1:NP_001163560.1 Gene:Kcmf1 / 41082 FlyBaseID:FBgn0037655 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_079561.1 Gene:Stmn2 / 20257 MGIID:98241 Length:179 Species:Mus musculus


Alignment Length:66 Identity:16/66 - (24%)
Similarity:34/66 - (51%) Gaps:10/66 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   422 EALDLNASDESLAKSDNVNKGQQQQQEDAEAEAQAETLLNNNADVEQQQQQQQLQPAMVRQVNQM 486
            :||:.|.:...:|:...:.| .:|.:|:.||         |.|.:.::.|:::...|.||:..::
Mouse   119 KALEENNNFSKMAEEKLILK-MEQIKENREA---------NLAAIIERLQEKERHAAEVRRNKEL 173

  Fly   487 Q 487
            |
Mouse   174 Q 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kcmf1NP_001163560.1 ZZ_PCMF_like 7..55 CDD:239078
zf-Di19 76..137 CDD:310299
Stmn2NP_079561.1 Membrane attachment. /evidence=ECO:0000255 1..26
Stathmin 39..174 CDD:395674 15/64 (23%)
Regulatory/phosphorylation domain. /evidence=ECO:0000255 39..96
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1280
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.