DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Iru and YBR062C

DIOPT Version :9

Sequence 1:NP_649859.1 Gene:Iru / 41080 FlyBaseID:FBgn0037653 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_009618.2 Gene:YBR062C / 852354 SGDID:S000000266 Length:180 Species:Saccharomyces cerevisiae


Alignment Length:131 Identity:34/131 - (25%)
Similarity:60/131 - (45%) Gaps:35/131 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 GGVGGGGNSHMFFMGNPGDYAWGREGLDTIVTQMLNQMETSGPPPLSAQRINEI--------PNV 240
            |...|.|::|       .|        .|::.::|:||.   |..|..:.:.|:        |:.
Yeast    44 GNTSGEGDAH-------SD--------STLLLRLLSQML---PESLQEEWLQEMDKGKSAGCPDT 90

  Fly   241 ------QINAEEVNRKIQCSICWDDFKIDE--TVRKLP-CSHLYHENCIVPWLNLHSTCPICRKS 296
                  :||.:::.....||||:.::..||  .|.:|| |.|.:...|:..||:..:|||:||.:
Yeast    91 FAASLPRINKKKLKATDNCSICYTNYLEDEYPLVVELPHCHHKFDLECLSVWLSRSTTCPLCRDN 155

  Fly   297 L 297
            :
Yeast   156 V 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IruNP_649859.1 zinc_ribbon_9 16..46 CDD:373030
RING-H2_RNF126_like 252..294 CDD:319581 17/44 (39%)
HRD1 <253..372 CDD:227568 19/48 (40%)
RING-H2 finger (C3H2C3-type) 253..293 CDD:319581 17/42 (40%)
YBR062CNP_009618.2 RING_Ubox 109..153 CDD:418438 17/43 (40%)
RING-H2 finger (C3H2C3-type) 109..152 CDD:319361 17/42 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.