DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Iru and AT1G60360

DIOPT Version :9

Sequence 1:NP_649859.1 Gene:Iru / 41080 FlyBaseID:FBgn0037653 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_176239.1 Gene:AT1G60360 / 842331 AraportID:AT1G60360 Length:327 Species:Arabidopsis thaliana


Alignment Length:317 Identity:83/317 - (26%)
Similarity:120/317 - (37%) Gaps:108/317 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FFCHMCNVEINIPN---SDFTCPLCANGFVEELPAN----------APEMDSSTAGASGSARS-- 66
            ::|:.|:..:.|.:   |:..||.|...||.|:...          .|..|:|.......|.|  
plant    24 YWCYHCDRMVRIASSNPSEIACPRCLRQFVVEIETRQRPRFTFNHATPPFDASPEARLLEALSLM 88

  Fly    67 ------GSSGSGSSGSHDTLSRGSSSSGSQVNVESLRNDIVSLLNMRNVPNLEITIEP--NRRHS 123
                  |..|:      |...|..|                     ||:...|....|  .||||
plant    89 FEPATIGRFGA------DPFLRARS---------------------RNILEPESRPRPQHRRRHS 126

  Fly   124 NVLHLGGFGGPSGSDSARGLTAGGRVRPANLDRLDNVLFDFLQSLPLAGATAEIV-----TGPGG 183
                                          ||.::|      ..|||...|..|:     |.|.|
plant   127 ------------------------------LDNVNN------GGLPLPRRTYVILRPNNPTSPLG 155

  Fly   184 GGVGGGG-------NSHMFFMGNPGDYAWGREGLDTIVTQMLNQMETSGPPPLSAQRINEIPNVQ 241
            ..:....       |||        ||..|...|:.::.| |.|.:..||||.|...||.:|:|:
plant   156 NIIAPPNQAPPRHVNSH--------DYFTGASSLEQLIEQ-LTQDDRPGPPPASEPTINSLPSVK 211

  Fly   242 INAEEV-NRKIQCSICWDDFKIDETVRKLPCSHLYHENCIVPWLNLHSTCPICRKSL 297
            |..:.: |...||::|.::|.:.....:|||.|:||::||||||.|:::|||||:.|
plant   212 ITPQHLTNDMSQCTVCMEEFIVGGDATELPCKHIYHKDCIVPWLRLNNSCPICRRDL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IruNP_649859.1 zinc_ribbon_9 16..46 CDD:373030 9/31 (29%)
RING-H2_RNF126_like 252..294 CDD:319581 20/41 (49%)
HRD1 <253..372 CDD:227568 22/45 (49%)
RING-H2 finger (C3H2C3-type) 253..293 CDD:319581 18/39 (46%)
AT1G60360NP_176239.1 zinc_ribbon_9 24..56 CDD:373030 9/31 (29%)
RAD18 199..>325 CDD:227719 30/70 (43%)
RING_Ubox 223..265 CDD:388418 20/41 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 1 1.000 - - FOG0000184
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15710
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X390
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.980

Return to query results.
Submit another query.