DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Iru and AT1G50350

DIOPT Version :9

Sequence 1:NP_649859.1 Gene:Iru / 41080 FlyBaseID:FBgn0037653 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_175452.1 Gene:AT1G50350 / 841457 AraportID:AT1G50350 Length:133 Species:Arabidopsis thaliana


Alignment Length:212 Identity:45/212 - (21%)
Similarity:68/212 - (32%) Gaps:101/212 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 AEA-KRFFCHMCN--VEINIPNSDFTCPLCANGFVEELPANAPEMDSSTAGASGSARSGSSGSGS 73
            ||| |..||:..:  :.|:|.:|...||||..||::|.      :|.                  
plant    14 AEAEKMLFCYQYDQTITISITSSADPCPLCNGGFLDEY------VDP------------------ 54

  Fly    74 SGSHDTLSRGSSSSGSQVNVESLRNDIVSLLNMRNVPNLEITI-EPNRRHSNVLHLGGFGGPSGS 137
                                           |...:|||.:.: :|.....:.:.:..|..||  
plant    55 -------------------------------NPNPIPNLILPMSDPISSRFSFIPVMDFTNPS-- 86

  Fly   138 DSARGLTAGGRVRPAN----LDRLD-NVLFDFLQSLPLAGATAEIVTGPGGGGVGGGGNSHMFFM 197
                  ..|..:.|.:    |:..| |.|.|  |:.|||                          
plant    87 ------FLGESMEPQSTQQQLNAFDPNQLSD--QANPLA-------------------------- 117

  Fly   198 GNPGDYAWGREGLDTIV 214
            ||.|||.:|| ||:.::
plant   118 GNHGDYFFGR-GLEDLI 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IruNP_649859.1 zinc_ribbon_9 16..46 CDD:373030 11/31 (35%)
RING-H2_RNF126_like 252..294 CDD:319581
HRD1 <253..372 CDD:227568
RING-H2 finger (C3H2C3-type) 253..293 CDD:319581
AT1G50350NP_175452.1 zinc_ribbon_9 19..51 CDD:405118 11/31 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.