DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Iru and AT1G26800

DIOPT Version :9

Sequence 1:NP_649859.1 Gene:Iru / 41080 FlyBaseID:FBgn0037653 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_564263.1 Gene:AT1G26800 / 839223 AraportID:AT1G26800 Length:204 Species:Arabidopsis thaliana


Alignment Length:134 Identity:44/134 - (32%)
Similarity:70/134 - (52%) Gaps:19/134 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 GREGLDTIVTQMLNQMETSGPPPLSAQRINEIPNVQINAEEVNRKIQCSICWDDFKIDETVRKLP 270
            |..|::.::..:|...| .|.||.|...|:.:|.|:|:..|.    :|.||.:::|.:|||:::|
plant    71 GSSGMNPLLRSLLESRE-EGRPPASKASIDAMPIVEIDGCEG----ECVICLEEWKSEETVKEMP 130

  Fly   271 CSHLYHENCIVPWLNLHSTCPICRKSLADDG-------NDADDEFVMLDAFGPE------MAADG 322
            |.|.:|..||..||..|.:||:||..:..||       ||.::.:|.. :|...      .|.||
plant   131 CKHRFHGGCIEKWLGFHGSCPVCRYEMPVDGDEIGKKRNDGNEIWVRF-SFNDGRRIRDFSAQDG 194

  Fly   323 SNSE 326
            .||:
plant   195 GNSD 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IruNP_649859.1 zinc_ribbon_9 16..46 CDD:373030
RING-H2_RNF126_like 252..294 CDD:319581 18/41 (44%)
HRD1 <253..372 CDD:227568 31/87 (36%)
RING-H2 finger (C3H2C3-type) 253..293 CDD:319581 18/39 (46%)
AT1G26800NP_564263.1 RING_Ubox 112..157 CDD:418438 20/44 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 1 1.000 - - FOG0000184
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15710
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.