DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Iru and AT1G18760

DIOPT Version :9

Sequence 1:NP_649859.1 Gene:Iru / 41080 FlyBaseID:FBgn0037653 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_173311.1 Gene:AT1G18760 / 838458 AraportID:AT1G18760 Length:224 Species:Arabidopsis thaliana


Alignment Length:141 Identity:36/141 - (25%)
Similarity:54/141 - (38%) Gaps:30/141 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 VTGPGGGGVGGGGNSHMFFMGNPGD------YAWGREGLDTIVTQMLNQMETSGPPPLSAQRINE 236
            ||.|..|....|.:..:..:..|.|      |....|.|.....|:...:..|         :.|
plant    88 VTNPARGDYSPGDDLLVSLLIFPNDEPIEEEYEIEEEDLSEEEDQIEEAVRAS---------LEE 143

  Fly   237 IPNVQI---NAEEVN---RKI---------QCSICWDDFKIDETVRKLPCSHLYHENCIVPWLNL 286
            ..|:.:   |...||   |||         :|:||.::|.....|..|||.|.:.:.|::.|...
plant   144 TNNISLRPANKLVVNSLARKIYKKTTSSTERCTICLEEFNDGTKVMTLPCGHEFDDECVLTWFET 208

  Fly   287 HSTCPICRKSL 297
            :..||:||..|
plant   209 NHDCPLCRFKL 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IruNP_649859.1 zinc_ribbon_9 16..46 CDD:373030
RING-H2_RNF126_like 252..294 CDD:319581 13/41 (32%)
HRD1 <253..372 CDD:227568 16/45 (36%)
RING-H2 finger (C3H2C3-type) 253..293 CDD:319581 13/39 (33%)
AT1G18760NP_173311.1 RING_Ubox 173..217 CDD:418438 14/43 (33%)
RING-H2 finger (C3H2C3-type) 175..215 CDD:319361 13/39 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15710
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.