DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Iru and AT5G60820

DIOPT Version :9

Sequence 1:NP_649859.1 Gene:Iru / 41080 FlyBaseID:FBgn0037653 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_200890.1 Gene:AT5G60820 / 836203 AraportID:AT5G60820 Length:419 Species:Arabidopsis thaliana


Alignment Length:296 Identity:69/296 - (23%)
Similarity:108/296 - (36%) Gaps:109/296 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 NSDFTCPLCANGF-VEELPANA-----PEMDSSTAG--ASGSARSGSSGSGSSGSHDTLS----- 81
            ::..|.|||.:.. :|:|..|.     .|:||....  .|..|.:..:.|.|.....|:|     
plant   208 DASVTIPLCWDSLQLEDLGINNEDCEWEEVDSDDEREVLSVLAEADDNNSVSVSVAATISLEDLA 272

  Fly    82 ----RGSSSSGSQVNVESLRNDIVSLLNMRNVPNLEITIEPNRRHSNV-LHLGGFGGPSGSDSAR 141
                ||||:.|.:|           |||.|   :||..::.  ..||: |::|            
plant   273 ISERRGSSNLGWEV-----------LLNSR---SLEFNLDD--AESNLELYIG------------ 309

  Fly   142 GLTAGGRVRPANLDRLDNVLFDFLQSLPLAGATAEIVTGPGGGGVGGGGNSHMFFMGNPGDYAWG 206
                       ::|..:....|:|.                                        
plant   310 -----------DIDHEEEDYEDYLH---------------------------------------- 323

  Fly   207 REGLDTIVTQMLNQMETS---GPPPLSAQRINEIPNVQINAEEV----NRKIQCSICWDDFKIDE 264
                 |...:||.:.|.|   |.||.|...|..:....::.|:|    :..:.|::|.::..:.:
plant   324 -----TTEYEMLFEAEISSGIGKPPASKSFIKNLKVSPLSNEDVMENDDDAVCCAVCKEEMIVGK 383

  Fly   265 TVRKLPCSHLYHENCIVPWLNLHSTCPICRKSLADD 300
            .|.:|||.|.||..||||||.:.:|||:||..|..|
plant   384 EVAELPCRHKYHSECIVPWLGIRNTCPVCRFELPSD 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IruNP_649859.1 zinc_ribbon_9 16..46 CDD:373030 5/16 (31%)
RING-H2_RNF126_like 252..294 CDD:319581 18/41 (44%)
HRD1 <253..372 CDD:227568 22/48 (46%)
RING-H2 finger (C3H2C3-type) 253..293 CDD:319581 18/39 (46%)
AT5G60820NP_200890.1 RING-H2_RNF126_like 372..413 CDD:319581 18/40 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 1 1.000 - - FOG0000184
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.