DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Iru and AT5G37220

DIOPT Version :9

Sequence 1:	NP_649859.1	Gene:	Iru / 41080	FlyBaseID:	FBgn0037653	Length:	380	Species:	Drosophila melanogaster
Sequence 2:	NP_198538.1	Gene:	AT5G37220 / 833696	AraportID:	AT5G37220	Length:	214	Species:	Arabidopsis thaliana

Alignment Length:	51	Identity:	18/51 - (35%)
Similarity:	29/51 - (56%)	Gaps:	4/51 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly   232 QRINEIPNVQ-INAEEVNRKIQCSICWDDFKIDETVRK-LPCSHLYHENCI 280
            ||:.|...|: |:.||  .|..||||.::...:.:... :.|.||:|::||
plant   140 QRLVEEQKVESIDLEE--EKKTCSICMENLNSESSSENIISCLHLFHQSCI 188

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Iru	NP_649859.1	zinc_ribbon_9	16..46	CDD:373030
		RING-H2_RNF126_like	252..294	CDD:319581	10/30 (33%)
		HRD1	<253..372	CDD:227568	10/29 (34%)
		RING-H2 finger (C3H2C3-type)	253..293	CDD:319581	10/29 (34%)
AT5G37220	NP_198538.1	RING-H2	160..>188	CDD:319362	8/27 (30%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1249953at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.920