DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Iru and AT5G01980

DIOPT Version :9

Sequence 1:NP_649859.1 Gene:Iru / 41080 FlyBaseID:FBgn0037653 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_195818.1 Gene:AT5G01980 / 831911 AraportID:AT5G01980 Length:493 Species:Arabidopsis thaliana


Alignment Length:341 Identity:85/341 - (24%)
Similarity:124/341 - (36%) Gaps:100/341 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FCHMCNVEINIP----NSDFTCPLCANGFVEELPANAPEMDSST------AG-----ASGSARSG 67
            |.|..|..|:..    .||.:....|:.||:  |.:..::|..|      ||     :....|..
plant   164 FPHADNDTISFSAYGGESDASTDRHADIFVQ--PDDRSDIDFDTDIDPMRAGLNQWNSDEEDREW 226

  Fly    68 SSGSGSSGSHDTLSRGSSSSGSQVNVESLRNDIVSLLNMRNVPNLEITIEP---NRRHSNVLHLG 129
            ..|:|.||...|..|...:|.|:......|.|         .|.||.:...   .||||      
plant   227 EEGAGPSGVAGTRYRNYLASPSESYSSMTRFD---------SPELERSFRQRIIERRHS------ 276

  Fly   130 GFGGPSGSDSARGLTAGGRVRPANLDRLDNVLFDFLQSLPLAGATAEIVTGPGGGGVGGGGNSHM 194
                                       |...:|..|:.|..:.                      
plant   277 ---------------------------LSRNIFTGLEDLDFSP---------------------- 292

  Fly   195 FFMGNPGDYAWGREGLDTIVTQMLNQMETS--GPPPLSAQRINEIPNVQINAEEVNRKIQCSICW 257
             :..|.|||. ...|.|.::.| |.:.:.|  |.||.|...:..:|.|.|..|.|.:.:.|:||.
plant   293 -YAANVGDYL-DERGFDELLEQ-LAESDNSRRGAPPASVSCVRNLPRVIIAEEHVMKGLVCAICK 354

  Fly   258 DDFKIDETVRKLPCSHLYHENCIVPWLNLHSTCPICRKSLADDGNDADDEFVMLDAFGPEMAADG 322
            :.|.:.....:|||.||||.:||||||:..::||:||..|..|..|.::        |.....|.
plant   355 ELFSLRNETTQLPCLHLYHAHCIVPWLSARNSCPLCRYELPTDDKDYEE--------GKRNVLDV 411

  Fly   323 SNSERRSASTATGTDN 338
            |..   |:|:..||::
plant   412 SED---SSSSDDGTES 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IruNP_649859.1 zinc_ribbon_9 16..46 CDD:373030 9/31 (29%)
RING-H2_RNF126_like 252..294 CDD:319581 19/41 (46%)
HRD1 <253..372 CDD:227568 31/86 (36%)
RING-H2 finger (C3H2C3-type) 253..293 CDD:319581 19/39 (49%)
AT5G01980NP_195818.1 RING_Ubox 350..391 CDD:418438 19/40 (48%)
RING-H2 finger (C3H2C3-type) 350..390 CDD:319361 19/39 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 1 1.000 - - FOG0000184
OrthoInspector 1 1.000 - - otm2990
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X390
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.