powered by:
Protein Alignment Iru and SGR9
DIOPT Version :9
Sequence 1: | NP_649859.1 |
Gene: | Iru / 41080 |
FlyBaseID: | FBgn0037653 |
Length: | 380 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_195895.2 |
Gene: | SGR9 / 831806 |
AraportID: | AT5G02750 |
Length: | 283 |
Species: | Arabidopsis thaliana |
Alignment Length: | 71 |
Identity: | 29/71 - (40%) |
Similarity: | 39/71 - (54%) |
Gaps: | 5/71 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 231 AQRINEIPNVQI-NAEEVNRKIQCSICWDDFKIDETVRKLPCSHLYHENCIVPWLNLHSTCPICR 294
|.|..|:.||.. ||.|| :|.||.::......|.::||.|.:|..||:|||:..:|||.||
plant 195 ALRAVEVFNVAASNAGEV----ECVICKEEMSEGRDVCEMPCQHFFHWKCILPWLSKKNTCPFCR 255
Fly 295 KSLADD 300
..|..|
plant 256 FQLPTD 261
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1249953at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000184 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR15710 |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 4.020 |
|
Return to query results.
Submit another query.