DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Iru and AT5G08139

DIOPT Version :9

Sequence 1:NP_649859.1 Gene:Iru / 41080 FlyBaseID:FBgn0037653 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_850790.1 Gene:AT5G08139 / 830709 AraportID:AT5G08139 Length:376 Species:Arabidopsis thaliana


Alignment Length:329 Identity:85/329 - (25%)
Similarity:126/329 - (38%) Gaps:80/329 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NIPNSDFTCPLCANGFVEELPANAPEMDSSTAGAS--GSARSGSSGSGSSGSHDTLSRGSSSS-- 87
            |:.:||..   .:|.|.|      |:.|....|.:  |......:.||:.....|:..||...  
plant    65 NLGDSDID---VSNDFDE------PDDDDFFVGRTDFGLEFRDIASSGNDIRLITVESGSDDDDG 120

  Fly    88 --------GSQVNVESL--------RNDIVSL----------LNMRNVPNLEITIEPNRRHSNVL 126
                    |..:|.|.:        .:|.||:          |..|.|...|...|         
plant   121 VENERELWGIDLNEEDVYVNDDDEYEDDDVSVTIPLCWDSLQLEDREVTADEFDWE--------- 176

  Fly   127 HLGGFGGPSGSDSARGLTAGGRVRPANLDRLDNVLFDFLQSLPLAGATAEIVTGPGGGGVGGGG- 190
            .:|| ||..|.|..|.:.:|.    |.:|..|..|......:.|.|    :||.....|.|..| 
plant   177 EVGG-GGGGGVDDEREIRSGF----AQIDMNDESLISASPIISLEG----LVTRERAEGSGNLGW 232

  Fly   191 ---------------NSHMFFMGNPGDYAWGREGLDTIVTQMLN-QMETSGPPPLSAQRINEIPN 239
                           |..::..|:..||.   :..|.:..|..: ::...|.||.|...:|.:|.
plant   233 EVLLNHTLEINFDVDNRELYIGGDHDDYV---QDYDMLFEQFADAEVSVIGLPPTSKSFLNNLPV 294

  Fly   240 VQINAE-EVNRKIQCSICWDDFKIDETVRKLPCSHLYHENCIVPWLNLHSTCPICRKSLADDGND 303
            |.:..| :.:..:.|::|.|:..|.....:|||:|.||..||||||.:.:|||:||..|..|  |
plant   295 VLLEGENDDDGGLVCAVCKDEMNIGNKAVQLPCNHKYHSECIVPWLKVRNTCPVCRYELPTD--D 357

  Fly   304 ADDE 307
            |:.|
plant   358 AEYE 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IruNP_649859.1 zinc_ribbon_9 16..46 CDD:373030 6/18 (33%)
RING-H2_RNF126_like 252..294 CDD:319581 19/41 (46%)
HRD1 <253..372 CDD:227568 26/55 (47%)
RING-H2 finger (C3H2C3-type) 253..293 CDD:319581 19/39 (49%)
AT5G08139NP_850790.1 RING-H2_RNF126_like 309..350 CDD:319581 19/40 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 1 1.000 - - FOG0000184
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.