DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Iru and BRH1

DIOPT Version :10

Sequence 1:NP_649859.1 Gene:Iru / 41080 FlyBaseID:FBgn0037653 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_191705.1 Gene:BRH1 / 825319 AraportID:AT3G61460 Length:170 Species:Arabidopsis thaliana


Alignment Length:89 Identity:29/89 - (32%)
Similarity:47/89 - (52%) Gaps:12/89 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 PLSAQRINEIPNVQINAEEVNRKIQ-----CSICWDDFKIDETVRKL-PCSHLYHENCIVPWLNL 286
            |.||..|.||..| |..||:....:     |::|..:|:.::.:|.| .|.|::|.:|:..|:: 
plant    65 PFSALLIREILPV-IKFEELTNSGEDLPENCAVCLYEFEGEQEIRWLRNCRHIFHRSCLDRWMD- 127

  Fly   287 H--STCPICRKSLADDGNDADDEF 308
            |  .|||:||.....|  :..:||
plant   128 HDQKTCPLCRTPFVPD--EMQEEF 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IruNP_649859.1 zinc_ribbon_9 16..46 CDD:433910
RING-H2_RNF126-like 252..294 CDD:438329 14/49 (29%)
HRD1 <253..372 CDD:227568 19/59 (32%)
BRH1NP_191705.1 RING_Ubox 94..140 CDD:473075 16/46 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.