DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Iru and AT3G60080

DIOPT Version :9

Sequence 1:NP_649859.1 Gene:Iru / 41080 FlyBaseID:FBgn0037653 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_191567.1 Gene:AT3G60080 / 825178 AraportID:AT3G60080 Length:306 Species:Arabidopsis thaliana


Alignment Length:412 Identity:89/412 - (21%)
Similarity:141/412 - (34%) Gaps:177/412 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EAKRFFCHMCNVEINI--------PNSDFTCPLCANGFVEELPANAPEMDSSTAGASGSARSGSS 69
            |.:.::||.|::.:::        .:|...||.|...|:|.:                       
plant    16 ERRTYWCHECDMSLSLLSSSDSDSDSSPLLCPQCRVDFLERM----------------------- 57

  Fly    70 GSGSSGSHDTLSRGSSSSGSQVNVESLRNDIVSLLNMRNVPNL-EITIEPNRRHSNVLHLGGFGG 133
                  .||     ||||                       || ::||            |.|..
plant    58 ------DHD-----SSSS-----------------------NLFDVTI------------GDFEE 76

  Fly   134 PSG-SDSARGLTAGGRVRPA-NLDRLDNVLFD--FLQSLPLAGATAEIVTGPGGGGVGGGGNSHM 194
            ..| :|..........|.|| |.|  ||.|.|  :|..| |....::          ..|.:|  
plant    77 QDGENDDEDDEEDWCFVDPAVNSD--DNFLLDSPYLHRL-LRHLASD----------NSGSSS-- 126

  Fly   195 FFMGNPGDYAWGREGLDTIVTQMLNQMETSGPPPLSAQRINEIPNVQINA--------EEVNRKI 251
                                    :...:|....|.:..|:.||.:||::        .:.:..:
plant   127 ------------------------SSSSSSSSSLLKSSDIDSIPTIQISSSLLCSTDDSDPDSVL 167

  Fly   252 QCSICWDDFKIDETVRKLPCSHLYHENCIVPWLNLHSTCPICR---------------------- 294
            .|::|.:||.|.|:.|:|||||:||.:||||||:.|::||:||                      
plant   168 LCAVCKEDFIIGESARRLPCSHIYHSDCIVPWLSDHNSCPLCRFELPTTAKVGIGGSEAEMRIRL 232

  Fly   295 ---KSLADDGNDADDEFV-------MLDAFGPEMAADGSNSERRSASTATGTDNPSPANNPSQAA 349
               .::|.||:|.:|:::       .|.....:|.......||..|.|.:|             .
plant   233 SDLATIAADGDDVEDDWLGIRNALRRLARRHEQMRLGVGEMERNLARTVSG-------------L 284

  Fly   350 AEGGRTRPDANPAQAARNNIFT 371
            ..|.|.|.:   .:|.|:|:.|
plant   285 GIGMRRREE---IEADRSNVTT 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IruNP_649859.1 zinc_ribbon_9 16..46 CDD:373030 9/37 (24%)
RING-H2_RNF126_like 252..294 CDD:319581 23/41 (56%)
HRD1 <253..372 CDD:227568 44/151 (29%)
RING-H2 finger (C3H2C3-type) 253..293 CDD:319581 23/39 (59%)
AT3G60080NP_191567.1 zinc_ribbon_9 18..57 CDD:405118 9/38 (24%)
RING-H2_RNF126_like 169..210 CDD:319581 23/40 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 72 1.000 Domainoid score I3298
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 1 1.000 - - FOG0000184
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.