DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Iru and AT3G56580

DIOPT Version :9

Sequence 1:NP_649859.1 Gene:Iru / 41080 FlyBaseID:FBgn0037653 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_001030874.1 Gene:AT3G56580 / 824825 AraportID:AT3G56580 Length:320 Species:Arabidopsis thaliana


Alignment Length:348 Identity:87/348 - (25%)
Similarity:139/348 - (39%) Gaps:80/348 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FCHMCNVEINIPNSDFTCPLCANGFVEELPANAPEMDSSTAGASGSARSGSSGSGSSGSHDTLSR 82
            :||.|...:.:...|..|..|..|||||:..                       |.|.:|..:.|
plant     9 WCHRCQRAVWLRARDAVCSYCGGGFVEEIDI-----------------------GPSRAHRDVER 50

  Fly    83 GSSSSGSQVNVESLRNDIVSLLNMRNVPNLEITIEPNRRHSNVLHLGGFGGPSGSDSARGLTAGG 147
            ..:....:.....:|:.:......|.:..               .||..|..|.|:.|..|..||
plant    51 DPTFDLMEAFSAFMRSRLAERSYDREISG---------------RLGSAGSESFSNLAPLLIFGG 100

  Fly   148 RVRPANLDRLDNVLFDFLQSLPLAGATAEIVTGPGGG-GVGGGGNSHMFFMGNPGDYAWGREGLD 211
            :. |..|...||            .:....|.|...| |:..|.|:        |||.:| .||:
plant   101 QA-PFRLAGGDN------------SSVEAFVNGAAPGIGIARGTNA--------GDYFFG-PGLE 143

  Fly   212 TIVTQMLNQMETSGPPPLSAQRINEIPNVQINAEEV-NRKIQCSICWDDFKIDETVRKLPCSHLY 275
            .::.|:.:.....||||.....|:.:|.::|..:.: :....|.:|.|:|::....:::||.|:|
plant   144 ELIEQLSSGTHHRGPPPAPKSSIDALPTIKITQKHLKSSDSHCPVCKDEFELKSEAKQMPCHHIY 208

  Fly   276 HENCIVPWLNLHSTCPICRKSLADDGNDADDEFVMLDAFGPEMAADG-SNSERRS---------A 330
            |.:||||||..|::||:|||.|...|:.:..:      .....:.:| .||.||:         :
plant   209 HSDCIVPWLVQHNSCPVCRKELPSRGSSSSTQ------SSQNRSTNGRENSRRRNIFSNLWPFRS 267

  Fly   331 STATGTDNPSPANNPSQAAAEGG 353
            |:::.|.|....||  .|.||.|
plant   268 SSSSSTQNRRDTNN--TATAEEG 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IruNP_649859.1 zinc_ribbon_9 16..46 CDD:373030 10/27 (37%)
RING-H2_RNF126_like 252..294 CDD:319581 18/41 (44%)
HRD1 <253..372 CDD:227568 37/111 (33%)
RING-H2 finger (C3H2C3-type) 253..293 CDD:319581 18/39 (46%)
AT3G56580NP_001030874.1 zinc_ribbon_9 6..37 CDD:405118 10/27 (37%)
RING-H2_RNF126_like 186..227 CDD:319581 18/40 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 72 1.000 Domainoid score I3298
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 1 1.000 - - FOG0000184
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102823
Panther 1 1.100 - - O PTHR15710
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X390
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.880

Return to query results.
Submit another query.