DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Iru and AT3G02340

DIOPT Version :9

Sequence 1:NP_649859.1 Gene:Iru / 41080 FlyBaseID:FBgn0037653 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_001327209.1 Gene:AT3G02340 / 821090 AraportID:AT3G02340 Length:409 Species:Arabidopsis thaliana


Alignment Length:303 Identity:81/303 - (26%)
Similarity:123/303 - (40%) Gaps:72/303 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GFVEELPANAPEMDSSTAGASGS-ARSGSSGSG-------------SSGSHDTLSRGSSSSGSQV 91
            ||.:  |....|.:....|.||| .:.|.||..             ..|..|.:|  ..|||::.
plant   109 GFYD--PKEDEEEEEIVLGTSGSDLQPGDSGEQGLRVTGIDSDSDCEDGVFDFIS--EDSSGNRG 169

  Fly    92 NVESLRNDIVSLLNMRNVPNL------EITI---EPNRRHSNVLHLGGFGGPSGSDSARGLTAGG 147
            | :|.|.::.:     .:|.:      |.|:   |......|.::...|.||...|....|::..
plant   170 N-DSGRVEVGT-----GLPPVWDHLFGEGTVLADEEWEEVQNAINWTAFSGPEDEDEEDELSSLS 228

  Fly   148 RVRPANLDRLDNVLFDFLQSLPLAGATAEIVTGPGGGGVGGGGNSHMFFMGNPGD-----YAW-- 205
            |.     |..::...|:...|.:......|....|             .|.||.|     |.:  
plant   229 RD-----DEEEDHELDWQVLLTVNNVVNYIEQAEG-------------IMLNPDDIDPDYYLYLS 275

  Fly   206 ----------GREGLDTIVTQMLNQMETS--GPPPLSAQRINEIPNVQINAEEVNR-KIQCSICW 257
                      |....|.|:.||.:. ||.  |.||.:...|.::|.|::..||::: ...|::|.
plant   276 GLDEFDENHSGHYDADAILGQMFDD-ETGIRGNPPAAKSVIQDLPVVELAVEELDKGNNVCAVCK 339

  Fly   258 DDFKIDETVRKLPCSHLYHENCIVPWLNLHSTCPICRKSLADD 300
            |:..::|.||:|||||.||..||:|||.:.:|||:||..|..|
plant   340 DEMLVEEKVRRLPCSHFYHGECIIPWLGIRNTCPVCRYELPTD 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IruNP_649859.1 zinc_ribbon_9 16..46 CDD:373030 2/4 (50%)
RING-H2_RNF126_like 252..294 CDD:319581 21/41 (51%)
HRD1 <253..372 CDD:227568 25/48 (52%)
RING-H2 finger (C3H2C3-type) 253..293 CDD:319581 21/39 (54%)
AT3G02340NP_001327209.1 RING-H2_RNF126_like 335..376 CDD:319581 21/40 (53%)
RING-H2 finger (C3H2C3-type) 335..375 CDD:319581 21/39 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 1 1.000 - - FOG0000184
OrthoInspector 1 1.000 - - otm40244
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.