DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Iru and AT3G13430

DIOPT Version :9

Sequence 1:NP_649859.1 Gene:Iru / 41080 FlyBaseID:FBgn0037653 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_001030687.1 Gene:AT3G13430 / 820543 AraportID:AT3G13430 Length:315 Species:Arabidopsis thaliana


Alignment Length:357 Identity:93/357 - (26%)
Similarity:155/357 - (43%) Gaps:62/357 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VEDRPAEAKRFFCHMCNVEINIP---NSDFTCPLCANGFVEELPANAPEMDSSTAGASGSARSGS 68
            :||  |....::||||:..: ||   :....|..|.:|||||:..|....      |:.|..:..
plant     1 MED--ASETSYWCHMCSRSV-IPLIQDEIIKCNFCQSGFVEEMDNNDDHQ------AADSLWTPI 56

  Fly    69 SGSGSSGSHDTLSRGSSSSGSQVNVESLRNDIVSLLNMRNVPNLEIT--IEPNR----RHSNVLH 127
            .....:.:||..|.....|.|.:..|....|.....:..|...::||  :|..|    |||..: 
plant    57 LMEMMNNNHDQHSTNQEDSESILEDEDEDEDDGDDGDQNNDGEIDITHQLEEIRRIRTRHSTAI- 120

  Fly   128 LGGFGGPSGSDSARGLTAGGRVRPA-NLDRLDN-----VLFDFLQSLPLAGATAEIVTGPGGGGV 186
                     .:..:|:.||..:... |.|..||     ::..|.|.:.:...:.:..:.|.    
plant   121 ---------VNLLQGIRAGLLIESENNEDNPDNSELVVLINSFNQRIRVHQDSVDTTSVPS---- 172

  Fly   187 GGGGNSHMFFMGNPGDYAWGREGLDTIVTQML-NQMETS-GPPPLSAQRINEIPNVQINAEEVNR 249
                       |:.|||..| .|.:|::.::. |.:... |.||.:.:.:..:..|:|.    :.
plant   173 -----------GSLGDYFIG-PGFETLLQRLAENDLNNRYGTPPATKEAVEALAMVKIE----DS 221

  Fly   250 KIQCSICWDDFKIDETVRKLPCSHLYHENCIVPWLNLHSTCPICRKSLADDGNDADDEFVMLDAF 314
            .:|||:|.|||:|....:::||.|.:|.:|::|||.|||:||:||..|.    ..||:....|| 
plant   222 LLQCSVCLDDFEIGMEAKEMPCKHKFHSDCLLPWLELHSSCPVCRYLLP----TGDDDEPKTDA- 281

  Fly   315 GPEMAADGSNSERRSASTATGTDNPSPANNPS 346
             .....|.:|.:..:||.|:...:|..::|.|
plant   282 -ETSRNDDNNEDISNASMASNGSSPDSSSNNS 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IruNP_649859.1 zinc_ribbon_9 16..46 CDD:373030 12/32 (38%)
RING-H2_RNF126_like 252..294 CDD:319581 21/41 (51%)
HRD1 <253..372 CDD:227568 35/94 (37%)
RING-H2 finger (C3H2C3-type) 253..293 CDD:319581 20/39 (51%)
AT3G13430NP_001030687.1 zinc_ribbon_9 7..40 CDD:405118 12/33 (36%)
RING-H2_RNF126_like 224..266 CDD:319581 21/41 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I1871
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 1 1.000 - - FOG0000184
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15710
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X390
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
88.030

Return to query results.
Submit another query.