DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Iru and AT2G44330

DIOPT Version :9

Sequence 1:NP_649859.1 Gene:Iru / 41080 FlyBaseID:FBgn0037653 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_181961.1 Gene:AT2G44330 / 819040 AraportID:AT2G44330 Length:180 Species:Arabidopsis thaliana


Alignment Length:118 Identity:38/118 - (32%)
Similarity:61/118 - (51%) Gaps:27/118 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 TQMLNQMETSGPPPLSAQRINEIPNVQI------NAEEVNRKIQCSICWDDFKIDETVRKLPCSH 273
            :|.|:.||:             :|.::|      :|...:..:.|:||.:||.:.|:.|:|||:|
plant    65 SQFLDPMES-------------LPTIKISSSMLSSASSDDSALPCAICREDFVVGESARRLPCNH 116

  Fly   274 LYHENCIVPWLNLHSTCPICRKSLADDGNDADDEFVMLDAFGPEMAADGSNSE 326
            |||.:||:|||..|::||:||..|....::.|.        |.:|..|..|.|
plant   117 LYHNDCIIPWLTSHNSCPLCRVELPVASSEDDS--------GLDMWFDALNLE 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IruNP_649859.1 zinc_ribbon_9 16..46 CDD:373030
RING-H2_RNF126_like 252..294 CDD:319581 22/41 (54%)
HRD1 <253..372 CDD:227568 31/74 (42%)
RING-H2 finger (C3H2C3-type) 253..293 CDD:319581 22/39 (56%)
AT2G44330NP_181961.1 RING-H2_RNF126_like 95..137 CDD:319581 22/41 (54%)
RING-H2 finger (C3H2C3-type) 96..136 CDD:319581 22/39 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 72 1.000 Domainoid score I3298
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 1 1.000 - - FOG0000184
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.