DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Iru and RHC1A

DIOPT Version :9

Sequence 1:NP_649859.1 Gene:Iru / 41080 FlyBaseID:FBgn0037653 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_001324188.1 Gene:RHC1A / 818680 AraportID:AT2G40830 Length:328 Species:Arabidopsis thaliana


Alignment Length:367 Identity:86/367 - (23%)
Similarity:137/367 - (37%) Gaps:96/367 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FCHMCNVEINIPNSDFTCPLCANGFVEELPANAPEMDSSTAGASGSARSGSSGSGSSGSHDTLSR 82
            :||.|...:.:...:..|..|..||||||       |.:.|......||.........:.|.:..
plant     9 WCHRCQRAVRLHGQEPVCFYCGGGFVEEL-------DMAQASPFDMFRSHRGVVERDQTFDLMDA 66

  Fly    83 GSSSSGSQVNVESLRNDIVSLLNMRNVPNLEITIEPNRRHSNVLHLGGFGGPSGSDSARGLTA-- 145
            .|         ..:||.:....:.|.:....|:                   ||.::..||..  
plant    67 FS---------VFMRNRLAERSHDREIRGRTIS-------------------SGPENFPGLAPLL 103

  Fly   146 --GGRVRPANLDRLDNVLFDFLQSLPLAGATAEIVTGPGGGGVGGGGNSHMFFMGNPGDYAWGRE 208
              ||:| |..|.. ||.:              |.:...|..|:|       ...||.|||.:| .
plant   104 IFGGQV-PYRLTG-DNAV--------------EALFNGGSPGIG-------ITRGNTGDYFFG-P 144

  Fly   209 GLDTIVTQMLNQMETSGPPPLSAQRINEIPNVQINAEEV-NRKIQCSICWDDFKIDETVRKLPCS 272
            ||:.:..|:.......||||.....|:.:|.::|....: :....|.:|.|:|::....:::||:
plant   145 GLEELFEQLSAGTTRRGPPPAPRSAIDALPTIKIAQRHLRSSDSNCPVCKDEFELGSEAKQMPCN 209

  Fly   273 HLYHENCIVPWLNLHSTCPICRKSLADDGNDADDEFVMLDAFGPEMAADGSNSERR-----SAST 332
            |:||.:||||||..|::||:||:.|.             .|.||..:.:.:...|.     |:|:
plant   210 HIYHSDCIVPWLVQHNSCPVCRQELP-------------SASGPSSSQNRTTPTRNYRSSSSSSS 261

  Fly   333 ATGTDNPSPANNP--------------SQAAAEGGRTRPDAN 360
            :...:|.:...||              |.....||....|.:
plant   262 SNSRENGNERRNPFSSFWPFRSSGSSSSSTQNRGGTRNSDTS 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IruNP_649859.1 zinc_ribbon_9 16..46 CDD:373030 9/27 (33%)
RING-H2_RNF126_like 252..294 CDD:319581 18/41 (44%)
HRD1 <253..372 CDD:227568 34/127 (27%)
RING-H2 finger (C3H2C3-type) 253..293 CDD:319581 18/39 (46%)
RHC1ANP_001324188.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 72 1.000 Domainoid score I3298
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I1871
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 1 1.000 - - FOG0000184
OrthoInspector 1 1.000 - - otm2990
orthoMCL 1 0.900 - - OOG6_102823
Panther 1 1.100 - - O PTHR15710
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X390
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.930

Return to query results.
Submit another query.