DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Iru and AT2G37580

DIOPT Version :10

Sequence 1:NP_649859.1 Gene:Iru / 41080 FlyBaseID:FBgn0037653 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_565865.1 Gene:AT2G37580 / 818334 AraportID:AT2G37580 Length:235 Species:Arabidopsis thaliana


Alignment Length:123 Identity:31/123 - (25%)
Similarity:52/123 - (42%) Gaps:17/123 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 TSGPPPLSAQRINEIPNVQINAEEVNRKI--QCSICWDDFKIDETVRKL-PCSHLYHENCIVPWL 284
            |...||::...:......:.:.:..:::|  :||:|...|...:.:|:| .|.|.:|..||..||
plant   110 TVDTPPITETTVTSESGGKFHKDTHSKEIGNECSVCLMVFTDSDELRQLSECKHAFHVLCIETWL 174

  Fly   285 NLHSTCPICRKSLADDGNDADDEFVMLDAFGPEMAADGSNSERRSAS----TATGTDN 338
            ..|..|||||          .|..|......|.:..:.:.:..||..    :||..|:
plant   175 KDHPNCPICR----------TDVSVKQQTEAPNVPVNVNGNVNRSGGNRRVSATSRDD 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IruNP_649859.1 zinc_ribbon_9 16..46 CDD:433910
RING-H2_RNF126-like 252..294 CDD:438329 17/42 (40%)
HRD1 <253..372 CDD:227568 27/91 (30%)
AT2G37580NP_565865.1 RING_Ubox 141..184 CDD:473075 17/42 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.