DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Iru and AT2G29840

DIOPT Version :10

Sequence 1:NP_649859.1 Gene:Iru / 41080 FlyBaseID:FBgn0037653 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_180545.2 Gene:AT2G29840 / 817534 AraportID:AT2G29840 Length:293 Species:Arabidopsis thaliana


Alignment Length:99 Identity:24/99 - (24%)
Similarity:41/99 - (41%) Gaps:22/99 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 DTIVTQMLNQMETSGPPPLSAQRINEIPNVQINAEEVNRKI------------QCSICWDDFKID 263
            :.::....|:..|:...|.|          ::..|.:|||.            .||||.::|...
plant   200 EQVLQASFNETNTARLKPAS----------KLAVESLNRKTYKKASDVVGENEMCSICLEEFDDG 254

  Fly   264 ETVRKLPCSHLYHENCIVPWLNLHSTCPICRKSL 297
            .::..|||.|.:.:.|.:.|...:..||:||..|
plant   255 RSIVALPCGHEFDDECALKWFETNHDCPLCRFKL 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IruNP_649859.1 zinc_ribbon_9 16..46 CDD:433910
RING-H2_RNF126-like 252..294 CDD:438329 13/41 (32%)
HRD1 <253..372 CDD:227568 16/45 (36%)
AT2G29840NP_180545.2 zf-RING_2 243..285 CDD:433370 13/41 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.