DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Iru and AT2G03000

DIOPT Version :9

Sequence 1:NP_649859.1 Gene:Iru / 41080 FlyBaseID:FBgn0037653 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_178400.1 Gene:AT2G03000 / 814829 AraportID:AT2G03000 Length:535 Species:Arabidopsis thaliana


Alignment Length:124 Identity:30/124 - (24%)
Similarity:49/124 - (39%) Gaps:38/124 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 WGREGLDTIVTQMLNQMETS------------------------------GPPPLSAQRINEIPN 239
            |.:|   |.||...:.|.||                              ...|.:.:.:..:|.
plant   411 WRKE---TYVTSSTSNMRTSSLMTLTRFIDEQISLRATVSSTRTTARLLTNESPATIRAVAMLPR 472

  Fly   240 VQINAEEVNRKIQCSICWDDFKIDETVRKLPCSHLYHENCIVPWLNLHSTCPICRKSLA 298
            |     .:..|.:|.||::::...:...:|||.|.||..|:..||.:|::||.||..|:
plant   473 V-----AMVEKGECVICFEEWSKSDMETELPCKHKYHLECVEKWLKIHTSCPQCRYKLS 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IruNP_649859.1 zinc_ribbon_9 16..46 CDD:373030
RING-H2_RNF126_like 252..294 CDD:319581 15/41 (37%)
HRD1 <253..372 CDD:227568 18/46 (39%)
RING-H2 finger (C3H2C3-type) 253..293 CDD:319581 15/39 (38%)
AT2G03000NP_178400.1 zf-rbx1 464..522 CDD:289448 18/62 (29%)
zf-RING_2 479..522 CDD:290367 15/42 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15710
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.