DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Iru and Rnf215

DIOPT Version :9

Sequence 1:NP_649859.1 Gene:Iru / 41080 FlyBaseID:FBgn0037653 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_082135.2 Gene:Rnf215 / 71673 MGIID:1918923 Length:379 Species:Mus musculus


Alignment Length:205 Identity:48/205 - (23%)
Similarity:76/205 - (37%) Gaps:61/205 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 ANLDRLDNVLFDFLQSLPLAGATAEIVTGP----------------GGGGVGGGGNSHMFFMG-- 198
            :|:.:|...|....|      |||||.:|.                |....|.||...:..:|  
Mouse   187 SNVTKLLEALLQRTQ------ATAEISSGESLSANIEWKLTLWTTCGLSKDGYGGWQDLVCLGGA 245

  Fly   199 -----NPGDYAWGREGLDTIVTQML----------------NQMETSGPPPLSAQR-INEIPNVQ 241
                 .|....|..    .::..||                ||.|..|...|..:| :..:.:::
Mouse   246 QAQEQKPLQQLWNA----ILLVAMLLCTGLVVQAQRQASRQNQQEPGGQEDLFKRRVVRRLASLK 306

  Fly   242 INAEEVNRKIQ---------CSICWDDFKIDETVRKLPCSHLYHENCIVPWLNLHSTCPICRKSL 297
            .....::|...         |::|.|.|...:.:|.|||.|.:|.:|:.|||.|..|||:|:.::
Mouse   307 TRRCRLSRAAHSLPEPGTETCAVCLDYFCNKQWLRVLPCKHEFHRDCVDPWLMLQQTCPLCKFNV 371

  Fly   298 ADDGNDADDE 307
            .  ||...|:
Mouse   372 L--GNHYSDD 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IruNP_649859.1 zinc_ribbon_9 16..46 CDD:373030
RING-H2_RNF126_like 252..294 CDD:319581 18/50 (36%)
HRD1 <253..372 CDD:227568 22/55 (40%)
RING-H2 finger (C3H2C3-type) 253..293 CDD:319581 18/39 (46%)
Rnf215NP_082135.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..63
zf-RING_2 325..368 CDD:290367 18/42 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.