DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Iru and Rnf149

DIOPT Version :10

Sequence 1:NP_649859.1 Gene:Iru / 41080 FlyBaseID:FBgn0037653 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_001028307.2 Gene:Rnf149 / 67702 MGIID:2677438 Length:394 Species:Mus musculus


Alignment Length:142 Identity:44/142 - (30%)
Similarity:67/142 - (47%) Gaps:27/142 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 GPPPLSAQRINEIPNVQINAEEVNRKIQCSICWDDFKIDETVRKLPCSHLYHENCIVPWLNLHST 289
            |..||...:..| ..:.::||      .|::|.::||:.:.:|.|||.|::|..||.|||..|.|
Mouse   244 GQLPLHTVKHGE-KGIDVDAE------NCAVCIENFKVKDVIRILPCKHIFHRICIDPWLLDHRT 301

  Fly   290 CPICR----KSLADDGNDADDEFVMLDAFGPEMAADG-----SNSERRSASTATGTDNPSPANNP 345
            ||:|:    |:|...|:..|.:.:......|...:.|     |..|.||.|           |.|
Mouse   302 CPMCKLDVIKALGYWGDPEDTQELPTPEAAPGRVSVGNLSVTSQDEERSES-----------NLP 355

  Fly   346 SQAAAEGGRTRP 357
            |.:::|.|..||
Mouse   356 SSSSSESGPHRP 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IruNP_649859.1 zinc_ribbon_9 16..46 CDD:433910
RING-H2_RNF126-like 252..294 CDD:438329 19/41 (46%)
HRD1 <253..372 CDD:227568 38/114 (33%)
Rnf149NP_001028307.2 PA_GRAIL_like 45..181 CDD:239037
RING-H2_RNF149 264..311 CDD:438455 20/46 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 321..394 15/58 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.