DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Iru and PJA1

DIOPT Version :9

Sequence 1:NP_649859.1 Gene:Iru / 41080 FlyBaseID:FBgn0037653 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_001369704.1 Gene:PJA1 / 64219 HGNCID:16648 Length:643 Species:Homo sapiens


Alignment Length:278 Identity:65/278 - (23%)
Similarity:108/278 - (38%) Gaps:63/278 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GFVEELPANAPEMDSSTAGASGSARSGSSGSGSSGSHDTLSRGSSSSG--SQVNVESLRNDIVSL 103
            |..|..|..| ::.:||..:.|...|.|:|:|:..     |.||:.|.  .:|...||:.:..| 
Human   398 GKEEREPPQA-KVSASTGTSPGPGASASAGAGAGA-----SAGSNGSNYLEEVREPSLQEEQAS- 455

  Fly   104 LNMRNVPNLEITIEPNRRHSNVLHLGGFGGPSGSDSARGLTAGGR--VRPA--------NLD--- 155
            |....:|.|:.       |.|            ..|:.|....|.  ::|.        ||:   
Human   456 LEEGEIPWLQY-------HEN------------DSSSEGDNDSGHELMQPGVFMLDGNNNLEDDS 501

  Fly   156 ------RLDNVLFD-FLQSLPLAGATAEIVTGPGGGGVGGGGNSHMFFMGNPGDYAWGREGLDTI 213
                  .:|..||| |...|.:|.|.:.:            ....:.:|......|...|.....
Human   502 SVSEDLEVDWSLFDGFADGLGVAEAISYV------------DPQFLTYMALEERLAQAMETALAH 554

  Fly   214 VTQMLNQMETSGPPPLSAQRINEIPNVQINAEE--VNRKIQCSICWDDFKIDETVRKLPCSHLYH 276
            :..:...:|.:. ||.|.:.|:.:|.:.:..:.  |.:::.|.||..::...|...:|||.|.:|
Human   555 LESLAVDVEVAN-PPASKESIDALPEILVTEDHGAVGQEMCCPICCSEYVKGEVATELPCHHYFH 618

  Fly   277 ENCIVPWLNLHSTCPICR 294
            :.|:..||....|||:||
Human   619 KPCVSIWLQKSGTCPVCR 636

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IruNP_649859.1 zinc_ribbon_9 16..46 CDD:373030 2/4 (50%)
RING-H2_RNF126_like 252..294 CDD:319581 15/41 (37%)
HRD1 <253..372 CDD:227568 17/42 (40%)
RING-H2 finger (C3H2C3-type) 253..293 CDD:319581 15/39 (38%)
PJA1NP_001369704.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..363
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 380..454 18/61 (30%)
RING-H2_PJA1_2 594..639 CDD:319379 17/43 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249953at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.